(data stored in ACNUC7421 zone)

EMBL: CP001825.PE103

CP001825.PE103       Location/Qualifiers
FT   CDS_pept        116161..116487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41027"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41027.1"
FT                   /translation="MGIFRRFFSGKQADKDGLYLYVKCNYCQEPIRIRVNPSTDLNPLY
FT                   EGPGDDPSGYELNKEIIGNRCFRLIRGTWYFDKSKRIIESNIEGGTEISAEEYNRLQGE
FT                   SSGE"
     ttgggtatct tcagaaggtt cttctctggc aaacaggcag acaaagatgg gttgtacctc        60
     tacgtcaagt gcaattactg ccaggaaccc atacgtatca gggtaaaccc atcaacagac       120
     ctaaaccctc tttatgaagg tcctggagac gatcctagcg gctatgagct caataaggag       180
     ataatcggca accggtgctt cagattgata agaggcactt ggtatttcga caaatccaag       240
     agaatcatag agagcaatat agaaggtggc accgagatat ctgccgagga atacaaccgc       300
     ttgcaaggag aatctagcgg agagtga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page