(data stored in ACNUC7421 zone)

EMBL: CP001825.PE104

CP001825.PE104       Location/Qualifiers
FT   CDS_pept        116484..117356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0106"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; 3-hydroxyacyl-CoA
FT                   dehydrogenase NAD-binding; KEGG: bur:Bcep18194_A4157
FT                   prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41028"
FT                   /db_xref="GOA:D1CDM2"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM2"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ACZ41028.1"
FT                   /translation="MKKEPSFGKVLIVGLGLIGGSIGLALTDNRVEVRGVTRSVSTLEE
FT                   ALRRGAITGGSTRLEDEAPHADLIILAAPTRTSINLITDLAQLAKEGTVITDVCSSKVD
FT                   VVRAMNQLPRHLRAVGGHPMAGKETPGISAAEKDLFLNSRWVLTETKRSDQESKSICEE
FT                   LAKLCGANVLWLDAEEHDLAVAYISHLPLLTSAALVLAAEEADTELTHKLAATGFRDST
FT                   RLAAGDHQMGVDLILTNSRNILQAINMFAHELQRMADAIEAGDEGKLRSLLEEAANIRR
FT                   NRYYKDNTH"
     gtgaagaagg aaccttcatt tggaaaggta ttgatagtag ggctcggact cataggaggc        60
     tctataggtc tagcgctgac cgacaacagg gttgaggtcc gaggagtgac caggagcgtt       120
     agtacgcttg aagaggctct gagaagggga gctataactg gaggctccac caggctggag       180
     gacgaggcac cacatgcgga cttgataata ctggcagctc ccacaagaac ctccataaat       240
     cttatcaccg atctggctca gctagctaaa gagggcacag taattaccga cgtatgtagt       300
     agtaaagttg acgtggtcag agcaatgaat cagcttccaa gacatctaag ggctgttggt       360
     gggcacccaa tggcagggaa ggaaacacct ggtatatcag cagctgagaa ggatctcttc       420
     ctgaactctc gttgggtact caccgaaacc aaaagatcag accaagaatc caaatccata       480
     tgcgaagaac tagcaaagct atgtggggcc aacgtactgt ggctagacgc cgaagagcat       540
     gatctggcag tcgcctacat cagccacttg ccactactca cttctgcagc cctagtacta       600
     gctgctgagg aggcagatac agaacttaca cataagttgg cagcaacagg ctttagggac       660
     agcacccgtt tagcagcagg cgaccaccaa atgggggtag acctcatact aactaattct       720
     cgaaatattc tccaagccat aaatatgttt gcacacgagc tgcagcgaat ggcagatgcc       780
     atagaagcag gagatgaggg caaactgcga tctctcctgg aagaagcggc caacatccgg       840
     agaaatcggt attataaaga taatactcat tag                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page