(data stored in ACNUC7421 zone)

EMBL: CP001825.PE105

CP001825.PE105       Location/Qualifiers
FT   CDS_pept        117416..118735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0107"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: 3-phosphoshikimate 1-
FT                   carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1- carboxyvinyltransferase); KEGG:
FT                   bha:BH1667 3-phosphoshikimate 1- carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41029"
FT                   /db_xref="GOA:D1CDM3"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM3"
FT                   /inference="protein motif:TFAM:TIGR01356"
FT                   /protein_id="ACZ41029.1"
FT                   /translation="MDITISPARSVHGNIMPPGDKSISHRAAIFGALAQGTTDIYNYSP
FT                   ARDCQSTLECLLSLGTGIRRDGNYIRVEGVGDTGFKEPESILDCGNSGTTMRLLIGALA
FT                   PMDLYAVLIGDKSLTKRPMDRVLKPLGDMGLRYYARNKDRYPPVSIRGGKIQGIHYQTP
FT                   VASAQVKSAILLAGLRAEGETVVTEPAKSRDHTERMLKAMGAQIQSDGTTVRLVASRLS
FT                   ATTFHVPADPSSAAFILAAALIVPESKVTTSNICLNPTRIGFLNVLERMGANIEIHNER
FT                   ESSGEPIGDIEASTSELNGIEIGGTEIPTLIDEIPILAVLATQAKGRTVIRDAEELRIK
FT                   ETDRISVLCRALQQMGADIREMRDGFEIHGPCKLKGAKVDPDHDHRIAMALAVASLIAE
FT                   DKTTILGAECASISYPNFWDHLSSLGVELSGTQSDSKTNV"
     ttggatatca ccatatctcc agcacgatcg gtccacggca atattatgcc gccgggagac        60
     aaaagtatat cccatagggc agcaattttt ggcgcgctag cccagggcac cacagatatc       120
     tataattact ccccagcccg agattgccaa tctacgctag aatgccttct atctcttggc       180
     accggaatac gcagggatgg caactatatt cgagtggagg gcgtgggaga tacaggcttc       240
     aaagagcctg aaagtatact agattgcggt aattcaggaa ccactatgcg cctgctaata       300
     ggtgccctag cccccatgga cctctatgct gtgcttatcg gggataaaag cctcacaaag       360
     agacccatgg acagggtact caaaccccta ggtgatatgg gacttagata ttacgctaga       420
     aacaaagaca gatatccacc agtatcaatc aggggaggca agattcaggg cattcattat       480
     caaactcctg tagctagcgc acaagtcaag agcgccatac tgttagctgg tttgagagct       540
     gaaggggaaa ctgttgtaac agagcctgcc aaatcaaggg atcatacaga gcgtatgctg       600
     aaagccatgg gggctcaaat acagtctgat ggaacaacag tcagactggt ggccagcagg       660
     ttgtcggcaa ccactttcca tgtccctgcc gatccttcat cagcagcctt cattctggca       720
     gcagccctta tagtacctga atcaaaagtt acaacaagca acatatgcct taacccaact       780
     agaatagggt tcttaaacgt gctggaaagg atgggggcta acatagaaat tcacaatgaa       840
     cgagaatctt caggggagcc cataggtgac atagaggctt ccacatcaga actaaatggc       900
     atagagatag gggggacgga gatccccact ctgatagacg agatacctat actagccgtt       960
     ttggctacac aggcaaaggg aagaacagtc ataagggacg ccgaagagtt aaggatcaaa      1020
     gaaaccgacc gcataagcgt actgtgcaga gcgctacagc agatgggagc cgatattaga      1080
     gagatgagag atgggttcga gatacatggg ccttgtaaac taaagggcgc taaggtagat      1140
     ccagatcacg accatagaat agctatggct ctagctgtag cctcacttat agccgaggac      1200
     aaaaccacta tcttaggagc agaatgtgct tcaatatcct acccaaactt ctgggatcat      1260
     ctctcatctc taggcgtaga gctaagcggc acacagtcag attcaaaaac taacgtatag      1320
//

If you have problems or comments...

PBIL Back to PBIL home page