(data stored in ACNUC7421 zone)

EMBL: CP001825.PE106

CP001825.PE106       Location/Qualifiers
FT   CDS_pept        118745..119614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0108"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: pca:Pcar_2150 shikimate 5-dehydrogenase-like
FT                   oxidoreductase; TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate dehydrogenase substrate binding domain protein;
FT                   Shikimate/quinate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41030"
FT                   /db_xref="GOA:D1CDM4"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM4"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ACZ41030.1"
FT                   /translation="MKQVGVIGYPIKHSISPVFQQAAFDALGIEAIYKAYEVPPEDLRS
FT                   FFFNLRNGNWLGVNVTIPHKSAAAKLADERSQEVSFTGAANTIISMNGRLKAHNTDISG
FT                   FILALEENGFQIKSKRAVVLGSGGTTRAVVYALAICEAQSIAVIGRSQDKVHSLISELK
FT                   PFFEHKQVTVTGHSWEKDSIRRQIQNSDILINTTPIGMKGTDQEHLSPVSKEDLSSDLI
FT                   VFDVVYNPIMTPLLTYAKDVGASTISGIEMLIYQGAESFRLWTGQEPPVDIMRKAAIKA
FT                   MEEKSRDV"
     atgaaacagg tcggtgtgat cggataccca ataaaacaca gcatatctcc agtctttcag        60
     caggcagcgt ttgatgcttt agggatagaa gctatctaca aagcttacga ggttccacct       120
     gaagatctaa gaagcttttt cttcaatcta agaaatggta actggctagg cgtaaacgtc       180
     actatcccac ataaaagtgc tgcagcgaag ctggcagatg aacgatctca agaagtatcc       240
     tttacgggag ccgccaacac cataattagc atgaatggta ggttgaaggc ccataacaca       300
     gatatatcag gattcatttt ggctcttgag gaaaatggat tccagatcaa gtctaaaagg       360
     gctgtggtgt taggcagcgg aggaaccact cgggcagtag tctatgcact tgctatttgc       420
     gaggctcaaa gcatagcggt tataggtaga agtcaggata aagttcattc tcttatatcc       480
     gagttaaaac ctttctttga gcataagcaa gtaacagtaa ccggtcattc ttgggagaaa       540
     gattcgataa ggcggcagat ccagaattct gatattctca taaatacaac ccccatagga       600
     atgaaaggga ctgatcagga gcatttatct cctgtgagta aagaagacct aagcagtgat       660
     cttattgttt ttgacgtcgt gtacaaccca ataatgacgc ccctgcttac ctacgccaag       720
     gatgtaggag cctctactat tagcggcata gagatgctca tttaccaggg ggcagaatct       780
     tttaggctat ggacaggaca agagcctcct gtggatatca tgcgcaaagc tgccataaaa       840
     gcaatggagg aaaaatctag agatgtttag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page