(data stored in ACNUC7421 zone)

EMBL: CP001825.PE109

CP001825.PE109       Location/Qualifiers
FT   CDS_pept        121195..121530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0111"
FT                   /product="2',3'-cyclic nucleotide
FT                   2'-phosphodiesterase/3'-nucleotidase bifunctional
FT                   periplasmic precursor protein"
FT                   /note="KEGG: bca:BCE_4194 2',3'-cyclic nucleotide 2'-
FT                   phosphodiesterase/3'-nucleotidase bifunctional periplasmic
FT                   precursor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41033"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM7"
FT                   /inference="similar to AA sequence:KEGG:BCE_4194"
FT                   /protein_id="ACZ41033.1"
FT                   /translation="MENTNKQEDRKVTRLPDAEAEGAGNFGAEPDNDPTAGNTPNAISA
FT                   LSETAQLPEAENPQEPTPLAEEGNRTGGEPSEDIVARHADSERDEQAADQQMEERGLPK
FT                   DMTIEEE"
     ttggaaaaca ctaataagca agaagataga aaagtaacca gattgccaga cgcagaggca        60
     gagggagctg gtaattttgg ggcagagcct gataacgacc caactgctgg aaacacacca       120
     aatgctatat ctgctctatc ggaaacagca caactacccg aagctgaaaa tccccaagaa       180
     cccaccccac tagcagaaga aggcaatcgt actggaggtg agccttctga agatatagtc       240
     gcacgtcatg ccgacagcga gagggatgag caggcagcag atcaacagat ggaagaacga       300
     ggtctgccca aggatatgac catagaggag gagtag                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page