(data stored in ACNUC7421 zone)

EMBL: CP001825.PE11

CP001825.PE11        Location/Qualifiers
FT   CDS_pept        11705..12451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0012"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; KR domain
FT                   protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bha:BH2491 3-oxoacyl-(acyl-carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40935"
FT                   /db_xref="GOA:D1CDC9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC9"
FT                   /inference="protein motif:TFAM:TIGR01830"
FT                   /protein_id="ACZ40935.1"
FT                   /translation="MDLEGKVALVTGGSRGIGRATAIKLASLGARVVVNYNRSKEAAEE
FT                   VVRAISEAGGEAVASPGDVSTKEGAENAVNTALNTWGKIDILVNNAGITRDTLLMRMSE
FT                   EDWEAVIDTNLKGAYLCSKLAVRSMLRNRWGRIINISSVVGLVGNVGQANYASAKAGLL
FT                   GLTKSIAREFGSKNITANAIAPGYIETDIVAVLSEDIKKAILSQIPAGRYGKPEEVAEL
FT                   VAFLASDKAAYINGQTINIDGGMVMI"
     gtggatctag aaggtaaagt ggccctggtg acaggaggat ccagggggat aggacgagcc        60
     accgccatta agttggcatc acttggtgct agggtagtgg tcaattacaa ccgcagcaag       120
     gaagctgcgg aggaggtagt gcgcgcgatc tcagaagccg gtggtgaagc agtagcctcg       180
     cctggagatg taagcaccaa ggaaggtgcc gaaaatgcgg tcaacacagc ccttaacacc       240
     tggggaaaga tcgatattct ggtgaacaac gccggcatca ctcgcgatac cctcctaatg       300
     aggatgtccg aagaggactg ggaagctgta atagacacta acctaaaagg ggcctaccta       360
     tgtagcaaat tggccgtacg gtctatgcta cgtaacaggt ggggcaggat catcaatata       420
     tcatcggtcg tgggcctggt aggaaacgtg ggacaagcca attatgcctc cgcaaaggca       480
     ggattactcg gcctgacgaa atctatagcc agagaatttg gcagtaaaaa tataaccgcc       540
     aatgccatcg caccaggata tatagagact gacatagtgg ctgtcctctc cgaggacata       600
     aagaaagcca ttctgtcaca gataccagcg gggcgctatg gcaagcctga agaggtagca       660
     gagttggttg ccttcctagc tagtgataaa gcagcttata taaatggcca gaccatcaac       720
     attgatggtg ggatggtcat gatataa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page