(data stored in ACNUC7421 zone)

EMBL: CP001825.PE110

CP001825.PE110       Location/Qualifiers
FT   CDS_pept        121535..121894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_3522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41034"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41034.1"
FT                   /translation="MPRNQWSKEREKEYQELKEEFEEEGRYKGREEEVAARIVNKQRRE
FT                   YGETKEAKAEDKEGSSPDRGLPIKNYDNLTVDEILSKSKGLSASVLKEIESYEKKHKNR
FT                   KTLLEQLDRMIGSKS"
     atgcccagga atcaatggtc caaagaaaga gaaaaagaat accaggaact caaggaagaa        60
     ttcgaagagg aaggtcgcta taaaggcaga gaagaagagg tagctgcgag gattgttaat       120
     aaacaaagac gtgaatatgg ggaaaccaaa gaggccaaag ctgaagacaa ggaaggaagc       180
     tcaccagatc gtggcctacc tatcaagaac tacgacaatc tcacagttga tgagatcctg       240
     agtaaatcca agggtctgtc ggcttctgtt ctgaaagaga tagaatccta cgagaagaaa       300
     cataagaaca gaaaaaccct gctcgagcag ctagatagga tgatcggcag taagtcatga       360
//

If you have problems or comments...

PBIL Back to PBIL home page