(data stored in ACNUC7421 zone)

EMBL: CP001825.PE111

CP001825.PE111       Location/Qualifiers
FT   CDS_pept        121891..122511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0113"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   aba:Acid345_3354 phage SPO1 DNA polymerase- related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41035"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM9"
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /protein_id="ACZ41035.1"
FT                   /translation="MKGSAVSDQYELDRVREEALFCQRCTLWQTRTQVVFGAGKAGSKI
FT                   MFVGEAPGEDEDRTGTPFVGRAGILLDQLLEEAGIGRESTYITNIIRCRPTAVTQGKIT
FT                   NRAPRAGEVSACEPWMWLEIHLVKPSVIVCVGAPAAKTLIDKNFRLSDQRGDVYEKEDG
FT                   IRYIATLHPAYLLRLLSTDTEAYQRAKGLVLQDLKKAKMLASR"
     atgaagggat cggctgtatc agaccagtat gagctagata gagtcaggga agaagcttta        60
     ttctgccaaa gatgtacctt atggcagact cgaacacagg tagtctttgg cgccggaaaa       120
     gcaggcagta agattatgtt tgtaggggaa gctcctggtg aagacgagga cagaactggg       180
     acaccatttg ttggtcgcgc tgggatcttg ctagaccagt tgctagagga agctggtata       240
     ggtagagaga gcacctatat caccaatatc atcaggtgtc gccctacagc tgttactcaa       300
     ggcaaaataa caaacagagc cccaagagct ggggaagtat ctgcatgtga gccttggatg       360
     tggcttgaga ttcatttagt gaaaccatca gtgatcgtgt gcgtgggagc accggcagcc       420
     aaaaccctga ttgataagaa ctttagactt agtgatcaga gaggagatgt gtacgagaaa       480
     gaggatggta ttaggtacat agctaccctt catcctgcct acctattacg ccttttgagt       540
     actgatacag aagcctacca aagagccaag ggactggtcc tccaggatct caaaaaagcc       600
     aagatgctag cctctcgata a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page