(data stored in ACNUC7421 zone)

EMBL: CP001825.PE113

CP001825.PE113       Location/Qualifiers
FT   CDS_pept        124030..124833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0115"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: lpf:lpl0291
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41037"
FT                   /db_xref="GOA:D1CDN1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACZ41037.1"
FT                   /translation="MPFASNGDLKIYYEEVGKGDPVVWIQGLGASNTAWNVQKFHFSQR
FT                   FRCIFIDNRDVGQSSRANADYTTKDMAEDVLCVLESANVDSAHIIGLSMGGAIAQELAL
FT                   NSPKKVKSLVLVSTFATPDARIRAVNAAWGELYGKVNRELFYKQVEPWLFSPSYLEKPS
FT                   NIRAFRRYIQHEPNPQETDAYQRQVRAVLSHNTADRLEKISNPTLIIAGEQDILVSPLH
FT                   SKLLAELIPNAELEIIPGAAHSVNLENQKEFNNRVRSFLESYLET"
     ttgccgtttg cttccaatgg ggatcttaag atctactacg aggaggtagg caaaggagat        60
     cctgttgtat ggatacaagg gttgggggct agcaacactg cctggaacgt acagaagttt       120
     catttctctc aacgctttcg gtgtattttc attgacaatc gagacgtagg gcagtcatcc       180
     agagctaatg cggattatac gaccaaagat atggcagagg atgtactctg cgtgctggaa       240
     agtgctaatg ttgatagtgc tcatatcata gggctgtcta tgggaggagc catagcacaa       300
     gaattagcac taaattcacc caagaaggta aagtcgctcg tactagtgtc aacatttgcc       360
     accccggatg ctagaatccg tgccgttaac gccgcatggg gagagcttta cgggaaggtc       420
     aaccgagagc ttttctataa gcaggtcgaa ccctggttat tctcccccag ttatttagaa       480
     aagccgtcaa acatcagagc cttcagaaga tacatccagc atgagcccaa tccccaggaa       540
     actgacgctt atcagcgtca agtgagggca gtactaagtc ataatactgc ggacagactc       600
     gagaagatta gtaaccctac gctcataata gctggcgagc aagatatact ggtctcccct       660
     cttcattcca aacttctggc tgaactgata cctaatgcgg agttggaaat tattccaggt       720
     gcagcccact cggtaaacct tgagaaccaa aaagagttca ataacagagt tcgatctttc       780
     ctggaaagct atttagagac atag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page