(data stored in ACNUC7421 zone)

EMBL: CP001825.PE114

CP001825.PE114       Location/Qualifiers
FT   CDS_pept        124912..126336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0116"
FT                   /product="Hyaluronidase"
FT                   /note="PFAM: Hyaluronidase; KEGG: Hyaluronidase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41038"
FT                   /db_xref="InterPro:IPR011496"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="PDB:5DIY"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN2"
FT                   /inference="protein motif:PFAM:PF07555"
FT                   /protein_id="ACZ41038.1"
FT                   /translation="MEYFRYRGIIEGFYGKPWEHQERLDMFEFMQANNLNAYIYAPKQD
FT                   LYHRELWREPYKEEQLQLFKELIEKAGSCGINFTFAISPGLSLVYSSEEELETLIRKIT
FT                   PFLEMGVHSIGIFFDDVPFDLIHEEDRNSYSNLAEAQADFLTRVLQRLESTISTPQIIM
FT                   CPTFYCNDPNLEYLRILGQRLPKNIDVFWTGPNVCSHEITTSHMQEVQKSLQRPATLWD
FT                   NYPVNDGGMMPELHIGPYDHRDPELHTHVVGIYANPMALPEASKLPLYTFAQYLNSPSQ
FT                   YNPQDSWRQAVSTLLGEDNLSAMEKFYQSNTISCLEPEEPAYLTNLFKKVQEDFASFRF
FT                   EQGLRTLREEIISMQTTYSRLSTQDSKFFWEIRPWLEEYKLWTDYLDQAMITFSNLFTG
FT                   FFTADEEQARESLQKALQGRTYLREVLKDAVDFRTRVCGDVVRNFLQQVLRSTVSIELQ
FT                   AEGKEWTALPPGIVRD"
     atggagtact tcagatatag gggaatcata gaaggtttct acggtaaacc gtgggagcat        60
     caggaaaggc tcgatatgtt cgagttcatg caagctaata acctgaatgc ctacatatac       120
     gcccccaaac aagacttata ccatcgagag ctttggagag aaccgtataa agaagagcag       180
     ctacaactct tcaaagagct catagagaaa gccggcagct gtggcataaa ctttacgttt       240
     gctatcagcc ctggactctc attggtgtac tcaagcgagg aagagcttga gaccctgatc       300
     agaaaaataa ctccgttcct tgagatggga gtacatagca tagggatatt ctttgatgat       360
     gtcccctttg acctcattca cgaagaagac agaaatagct actctaacct agcagaagct       420
     caggcagact ttcttacgag agttctccaa aggttggaga gcactataag tacccctcaa       480
     atcataatgt gcccgacctt ctactgcaac gatcccaacc tggaatacct tagaatactt       540
     gggcagaggt tacctaagaa catcgacgtc ttctggacag ggcctaacgt ttgctcccat       600
     gagatcacga caagtcatat gcaggaggtc caaaagtctc tgcagaggcc agctactctt       660
     tgggacaatt acccagtgaa tgacggcggt atgatgcctg agctgcatat aggaccctac       720
     gatcacaggg atcctgagct tcatacacac gtggtaggta tatacgccaa tcctatggct       780
     ctaccagaag cttccaagct acctctttat acctttgctc agtatctaaa ttctccaagc       840
     cagtacaacc cacaagattc ctggcggcag gctgtaagca ccttgcttgg cgaagacaac       900
     ttatctgcca tggaaaagtt ctatcaaagc aacactatca gctgcttaga acctgaggag       960
     cctgcttacc taacaaacct atttaagaaa gtacaagaag attttgcctc ctttagattc      1020
     gagcaaggac tacgcaccct tagagaagag ataatcagca tgcagaccac ctactcaagg      1080
     ctttccaccc aggacagtaa gttcttttgg gaaataagac catggttaga agagtataag      1140
     ttgtggactg attatcttga tcaagccatg attactttca gcaacttgtt tacaggattc      1200
     tttacagctg atgaagagca agcaagagag tctttgcaga aagctctaca ggggaggaca      1260
     tatctaagag aagtcctgaa ggacgcagtt gattttcgta ccagagtatg cggagacgta      1320
     gttcgtaact tccttcaaca ggtactgaga tcaactgtat ctattgagct acaagctgaa      1380
     ggcaaagagt ggacagcgct accacctggt atagttcgag actga                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page