(data stored in ACNUC7421 zone)

EMBL: CP001825.PE115

CP001825.PE115       Location/Qualifiers
FT   CDS_pept        complement(126345..129320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0117"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; KEGG: tbd:Tbd_2206 translocation protein TolB"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41039"
FT                   /db_xref="GOA:D1CDN3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41039.1"
FT                   /translation="MSDDSHASLTVADFTLADHLGLEALQVLVNPILPQLYDFIARRTI
FT                   DGQEAEDVLQQTLWLAFKTCYKSDQELGLLDWLLSIATRVLLNRVNSDPLCECGLGFLV
FT                   QDDSGRTNDKVSRLYGRLLASEISHFAKTQRFILGLFVHERWSIHRISTVLGISPHKVE
FT                   SSISTTVLQILIDLWPEEPESRLNRNDVYLITREILLGNISGSYPRIRSLIDTLSVKHT
FT                   TFSMPPNLEARLWKSCSADFPQQYVPPLAVGNDNIRVYLWAVAACIVLLFAAVLGANFF
FT                   GIDSSAKPSQVKTAERLVSDQNVSNRSDDSTSNIAARINGFVRDRYLSGRLVLLHYGPD
FT                   GNSVGVVDFDTGNIARDVFTDLSPNVVFAISPSGRYLAYGKQDAVMLSDIIDRSPPRWL
FT                   ITLQSPNTDRWRYEMDRTPHRFRVAALAWHPNEQILAVASEPIYYRGLEHSRVQLVRVR
FT                   NSGGETISTIVTLQSFEDVVSLDWSADGTQLLIGTDRRILLASFSRFGFWDLKQLPGRG
FT                   TATWSPDDKLVLWVSPSDSASGSSLFGVTNPSTGKSSTLGTCDYARWEDDPNYVVFLQG
FT                   VSNHSDRIVLSRMNLSSGEVDQVLQVAFKGNFESNALLSPDGRYLLYNDEDGLHLYDAK
FT                   FQESVWRLDYPPKEVISPLVWMSGWQSYDREFETLSGTIIYPKKSGSKVSLVSLDLRTG
FT                   STRQIAAASKLSYTVGDQALMVRTSKSNALLYTQEGIIKLYIPPKMQDITAVELTSSGS
FT                   TIAYATREGRGVAIWEITPQRSRVNLARSKPIAHLRTIPLSLDFSPSGRWILIKDRNNV
FT                   WHLFNNKFKRIKILPRADRYSWMVLDGKDVLVQLKNLNISIYTPRGKTVYEINGYVNAY
FT                   APLDDGYIAVWTMDDDLRVYDLRKKDFVTWGSMLGMDYSELDDSSLVQIVPISDGGSWI
FT                   ALRLRDSVYMLDLSNGYQYPLQIKATSAGELTWLSGDPNPQFRRYVDWDSCHEVPPDKC
FT                   PA"
     atgtccgacg atagccatgc cagcctgact gtagctgact ttactttggc tgatcatttg        60
     ggcctagaag ctctgcaggt gttggtgaac ccaatcttgc ctcagctata tgattttatt       120
     gccagaagaa ctatagatgg gcaagaggca gaggatgtcc tccagcagac cttatggctc       180
     gctttcaaga cttgttataa gtctgatcag gaattgggtc ttcttgactg gctactgtct       240
     atagcaactc gagtcctatt gaaccgcgtc aattctgatc ctttatgtga atgtggtctt       300
     ggttttctgg tccaggatga tagtggtcgc actaatgata aagtaagtag gctgtatggt       360
     aggcttttag cctctgagat ctctcatttt gccaagactc agcgatttat attagggctt       420
     tttgtacatg agcggtggtc tattcataga ataagtactg ttcttgggat ttctccacat       480
     aaagttgagt cctctatatc taccactgtt ctccaaatat tgatcgacct gtggccggag       540
     gagcctgaga gtcgcctgaa cagaaatgat gtttatctaa ttactcgaga aatacttcta       600
     ggcaatatat caggatctta tcctaggata agatcattaa ttgatacact ttccgtaaaa       660
     catactacat tctccatgcc tcctaatttg gaagctcgtc tctggaaatc ttgctctgct       720
     gattttcccc agcagtacgt accaccgcta gcggtgggta acgataatat ccgagtgtat       780
     ctatgggcgg tcgcagcttg tattgtcttg ctatttgctg cagttttggg agctaacttt       840
     ttcgggattg attcctccgc caagccgtcc caagttaaga ccgcggagag actggtaagt       900
     gatcaaaatg ttagtaaccg aagcgacgat tctaccagca atatagctgc caggatcaat       960
     ggctttgtaa gggatagata tctttctggt aggttagtac tcctgcacta tggtccagat      1020
     ggtaatagtg tgggagttgt ggatttcgac acaggtaaca tagcccgaga tgtcttcacc      1080
     gatctcagcc ccaatgttgt ctttgctatt tctccctctg gaagatactt ggcatatgga      1140
     aagcaggatg cggtaatgtt atcggacata attgatagat ccccgcccag atggctaata      1200
     actttgcagt ctccgaatac agatagatgg agatacgaga tggatcgtac gccccatcgc      1260
     tttcgtgtgg ctgctctagc ttggcatcct aacgaacaga tattggcggt ggctagcgaa      1320
     cctatctact atcgaggatt agaacattcc agggtgcagt tagtgagagt tcgtaactcg      1380
     ggaggggaga cgatcagtac catagttacg cttcaatctt ttgaggatgt cgtaagccta      1440
     gattggagtg cggatggtac tcagcttctt ataggaaccg atcgcagaat attgctagca      1500
     agcttttcta ggtttggttt ttgggatttg aagcagttac ctggtcgagg tactgccaca      1560
     tggtcgcctg atgataagtt ggtgctttgg gtatcaccat cggactctgc ttctggcagc      1620
     tcattattcg gggtgactaa tccctcgacg ggtaagtcta gcacgcttgg cacatgcgac      1680
     tacgctagat gggaagatga tcctaactac gtggtttttc tgcagggcgt aagtaaccat      1740
     agcgatcgta tagttctatc ccgtatgaat ctatcttcag gagaggtaga tcaagttcta      1800
     caagtagcat tcaaaggcaa ctttgaatct aatgccttgc tatctcctga tggtaggtac      1860
     ctgttatata acgacgaaga tgggctacat ctatatgatg ctaagtttca ggagagtgtt      1920
     tggaggctcg actatccacc gaaggaggtc atatctccgt tggtatggat gtcgggatgg      1980
     cagtcttatg atcgggagtt cgagactctt tcaggaacga taatctaccc taagaagagc      2040
     gggagcaaag tttctttggt gtcgttagat cttagaacag ggagtactag acagattgca      2100
     gccgcatcaa agctatcata tacggttggt gatcaagcac taatggtgag aacaagtaaa      2160
     agcaacgctc tgctctatac tcaggaaggt attatcaagc tttacattcc tcccaagatg      2220
     caagatatta ctgcagttga gttgacttct tccggtagta cgatcgcgta tgctaccagg      2280
     gaggggagag gtgtagcgat ttgggagatc actccgcaaa gaagtagggt caatctagcg      2340
     agatccaaac ctattgcaca ccttaggact ataccattga gcttggattt ctctccatct      2400
     ggtaggtgga tactaataaa ggacagaaat aacgtatggc atcttttcaa taataagttc      2460
     aagaggatca agattctccc cagggcagat cgttactcct ggatggtgct tgacggcaag      2520
     gatgttttgg tacagctcaa aaatctcaac atcagtattt atacaccgag aggtaagacc      2580
     gtctatgaaa taaacggcta tgttaatgct tatgctccct tagatgatgg atatatagct      2640
     gtatggacaa tggatgatga cctaagagtt tatgacttgc gtaaaaagga tttcgtgact      2700
     tggggatcta tgcttggcat ggattattct gaactggatg attccagctt agttcagatt      2760
     gtacctataa gtgatggtgg aagctggata gcgcttcgtt tgcgtgattc ggtatatatg      2820
     ctggaccttt ctaatggcta ccagtatccc ctgcagatca aggctacatc tgcaggggag      2880
     ctgacttggc taagtggaga tcctaaccca cagttcagaa gatatgttga ctgggattcc      2940
     tgccacgagg ttcccccaga caaatgccct gcataa                                2976
//

If you have problems or comments...

PBIL Back to PBIL home page