(data stored in ACNUC7421 zone)

EMBL: CP001825.PE12

CP001825.PE12        Location/Qualifiers
FT   CDS_pept        12514..13434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0013"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; KEGG: gur:Gura_1876
FT                   malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40936"
FT                   /db_xref="GOA:D1CDD0"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD0"
FT                   /inference="protein motif:TFAM:TIGR00128"
FT                   /protein_id="ACZ40936.1"
FT                   /translation="MSSRRIALVFPGQGSQYVGMGKALHDASEAAREVFKRADEILGFR
FT                   LSHLCFSGPEEDLQDTINAQPAIFTVSLATLAAIKEKLHEAGVKLNPSFVAGHSLGEYT
FT                   ALVAANVIDFEDGLRLVRERGRLMKEEGEKIPGGMAAVIGLDEEVIQRACEEASSEGIV
FT                   GIANSNSPGQIVISGELKALHRAMELLQQQGAKKVIKLPISIASHSPVMQRAAAQFAEI
FT                   VSHMKLRDPQIPIVANVTGQILTNVEDIRRELSHHITGPVQWTKSIREMLSHGTNGFIE
FT                   LGPKRVLTGLIQRISPGVDTISTDS"
     atgtcatcca ggaggatagc cctcgtcttc cctggtcaag gctcccagta cgtaggtatg        60
     ggcaaggccc tacacgacgc ctccgaggca gctagagaag tcttcaaaag ggctgatgag       120
     atactggggt tccggctctc acatctttgt ttctcaggac cagaggaaga cctacaggac       180
     acgatcaacg cgcagccagc gatattcact gtcagtttgg caactcttgc ggcgataaaa       240
     gaaaaattac acgaagcagg cgtaaagctg aatccatcgt tcgtagctgg tcacagccta       300
     ggagagtaca cagcgttggt agcagccaac gttatagact tcgaggatgg tctgcgcctc       360
     gtccgtgaga gaggaagact aatgaaagag gagggcgaga agatcccagg cgggatggca       420
     gccgttattg gccttgatga agaggtcatc caaagagcat gtgaagaagc atcaagtgag       480
     gggatagtag gtattgccaa ctcaaactcg ccggggcaga tagtgatctc aggggagcta       540
     aaggcgctgc acagagctat ggaactcctg caacaacagg gggccaagaa agtgatcaaa       600
     ctccctataa gcatagcctc ccactcaccg gtcatgcagc gtgcagctgc ccaatttgct       660
     gagatcgtga gtcatatgaa gcttcgagat ccacagatcc ccatagtcgc taacgtgact       720
     ggtcagatat tgactaatgt agaggacata agacgagaac tatctcatca tataactggt       780
     ccagtacagt ggacgaagag cattcgggaa atgctatcac atggtacaaa tggcttcatt       840
     gagctggggc ccaagagagt cctaactgga ctcatccaga ggataagccc cggcgtagat       900
     accatcagta ccgattccta g                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page