(data stored in ACNUC7421 zone)

EMBL: CP001825.PE120

CP001825.PE120       Location/Qualifiers
FT   CDS_pept        complement(134310..134750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0122"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: mes:Meso_3240
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41044"
FT                   /db_xref="GOA:D1CDN8"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN8"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACZ41044.1"
FT                   /translation="MATAQSKAHVDWSGDLLQGNGQVSVGSGSFGPLPISWRTRTERGG
FT                   GGTSPEELIAAAHAGCYAMALSNTLAKHGSPPENLSVDATCNFEFGEGGARITSIDLNV
FT                   TGRVPGLSEEEFKSIAEEAEKGCPVSNALRNNVDIRLNAQLA"
     atggctactg cgcaaagtaa ggctcatgtt gattggtcag gggatcttct gcagggtaat        60
     gggcaggtga gtgttggaag tggctctttt ggtccactac caataagctg gaggacgcgt       120
     actgaaaggg gaggtggtgg taccagtccc gaagagctaa ttgctgcagc acatgccggg       180
     tgctatgcca tggcgctatc caataccttg gctaagcatg ggtcacctcc ggaaaactta       240
     tctgtggatg caacttgtaa cttcgagttc ggggaaggtg gagctcgaat aactagtata       300
     gacctaaatg tgacgggtag agtgcctggt ttgagtgagg aagagttcaa atctattgct       360
     gaagaggcag aaaaaggctg tccggtgtct aatgctttac gcaataacgt tgatataaga       420
     ctgaacgctc aattagccta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page