(data stored in ACNUC7421 zone)

EMBL: CP001825.PE121

CP001825.PE121       Location/Qualifiers
FT   CDS_pept        134913..135194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41045"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41045.1"
FT                   /translation="MSYGRKITGTRDEVYDLISVLYHTLQAAETYVIYSEDADFSQDKE
FT                   LVSFFQELQEEDKRRAERAKELLRKRLLAEAEHEDTSTGEQEGPTVGI"
     atgagctatg gaagaaagat tacgggaaca agagatgaag tctatgatct tataagcgtt        60
     ctctatcaca cactgcaagc agcagagacc tatgtcatat atagcgaaga tgctgacttt       120
     agtcaggaca aagagcttgt aagcttcttc caggagcttc aagaggaaga caaaaggcga       180
     gctgaaagag ctaaggaact actccgcaag agactactag ctgaggcaga acatgaggac       240
     acctcaacag gagagcaaga agggccgacc gtaggaattt ag                          282
//

If you have problems or comments...

PBIL Back to PBIL home page