(data stored in ACNUC7421 zone)

EMBL: CP001825.PE122

CP001825.PE122       Location/Qualifiers
FT   CDS_pept        complement(135224..136057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0124"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sme:SM_b20969 putative
FT                   sugar uptake ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41046"
FT                   /db_xref="GOA:D1CDP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41046.1"
FT                   /translation="MVGRILHSTSVYIMLIALSLFILMPIGWMLTAALKPSTAPVFTYP
FT                   PEWFPTKYWEWKTFRDALFEENFFIYTRNTVILVLLNVVGALFSCSMIAYAFARLKFRG
FT                   KNLLFTILVATMLLPGPVLLIPQFLLFYRIGWYNTYFPLFVPAFTGNAFFIFLLRQYMK
FT                   TLPIELDEAARIDGASYWGIYWRIILPLSIPALTVVAVFQFLATWNDFFGPLIYLDDPD
FT                   KFTLALGLATMVRRVGTEWNEVMAANLVAVIPVLIVYFLAQNKLIGGIASVGLKG"
     atggttggta ggattttaca ttcgacatcc gtatacatta tgctaattgc tttgagtcta        60
     tttattttaa tgcctatagg ttggatgctt acagcagctt tgaagccttc tacagcgcct       120
     gtgtttactt atcctccgga atggtttcct actaagtact gggaatggaa gacatttcgg       180
     gatgccttat ttgaagagaa cttcttcatt tatactcgta acacagttat ccttgttctg       240
     cttaatgtgg taggtgcact attttcttgc tcaatgattg cttatgcctt tgcaagattg       300
     aagtttagag gcaaaaattt gttatttaca atccttgtag ctacgatgtt gctacccggc       360
     cctgtattgt taatcccaca atttctcttg ttctacagga taggttggta taacacgtac       420
     ttcccattgt ttgtgccagc gtttacggga aatgcctttt ttatatttct gcttagacaa       480
     tatatgaaga ccttacctat agaacttgat gaggctgcac gtatagatgg tgctagttac       540
     tggggaatat attggagaat aatattacct ttatctatac cagcgcttac tgtggtagca       600
     gtttttcagt ttcttgctac atggaatgat tttttcggtc cattaatata tttggatgat       660
     ccagacaaat tcacgctagc ccttggtctg gccactatgg taagacgtgt tgggacggaa       720
     tggaatgaag ttatggcagc taacctagtg gccgtaatac ctgtgcttat agtttacttt       780
     ttggcgcaga acaaactgat aggtggcata gcttctgttg gcctgaaggg ataa             834
//

If you have problems or comments...

PBIL Back to PBIL home page