(data stored in ACNUC7421 zone)

EMBL: CP001825.PE124

CP001825.PE124       Location/Qualifiers
FT   CDS_pept        complement(137074..138507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0126"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH1864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41048"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41048.1"
FT                   /translation="MSRINKMKIFSIIILLMLSISCGPGRESSGPPGVEQPTPTANVPA
FT                   QEQTPVGFDISKVTPETKPTPIVRGAWKDYDGPTVTISVWMYPQDEDSLKAYKDAFEEK
FT                   HPNIKIKYVVYPEDNYQTKINTALQAHKPPDVAVMENKAWMKAGKVVDLTPYYKQWGIF
FT                   VNDFAQGGVARFTLEKGPSQGIFGVGDFLGGNIIVYNKDMFDEARVSYPPADKSLTWPQ
FT                   YAEICKKVAKPDPNPTKRIYGCSVPPWGFGIWQKWLFGPNGKRALGNMNSPEMIEAWNV
FT                   GTELVREKYAPSGNVLQTLPNGEPDLFTQKRIAMTWTDFTFVKDYKAAGIDFGIAPWPV
FT                   IRGSESFVDTWTAPWGTFTESEHQHAALTFLKFMATDAQRIRGTVSADPPLSFKVAEQM
FT                   KWGQGDPLKEQYLQVLKVAAKAQPFVPPLPEGGYNPDDIYNKMTVQGVKDAKPLLDDAA
FT                   KRTQPLLDKAWQEWEKIGR"
     atgtctcgaa ttaataaaat gaagattttt tcaatcataa tcctgcttat gttatctata        60
     tcatgcggcc caggcagaga aagttcaggt cctcctgggg tggaacaacc tacacctaca       120
     gcgaatgttc ctgctcagga acagactcca gtggggtttg atatcagcaa agttacacct       180
     gagactaaac ccactcctat agtaagaggg gcttggaagg attatgatgg accaacagtt       240
     acaatctctg tatggatgta tcctcaggat gaagactctt tgaaggctta taaggacgcc       300
     tttgaagaaa agcaccctaa catcaagatc aagtatgtag tttacccgga agataactat       360
     caaacaaaaa tcaataccgc tttacaggcg cataaacctc cggatgttgc tgtaatggaa       420
     aataaagctt ggatgaaagc tggtaaagta gttgatctaa ctccctatta caagcaatgg       480
     ggtatatttg taaatgattt tgcacagggt ggtgttgcta gatttactct tgaaaaggga       540
     ccatcccaag gtatttttgg agttggagat ttcttgggag gcaacataat tgtctacaac       600
     aaggacatgt tcgatgaggc gagagtatcc tatcctccgg ctgataaatc attgacttgg       660
     ccacaatacg ccgagatatg taagaaagtt gccaagcctg atcctaaccc aactaaaagg       720
     atatacggat gttcagttcc tccttgggga tttggtattt ggcaaaagtg gctatttggc       780
     cctaatggta aacgtgcttt gggaaatatg aattctccag aaatgattga agcttggaat       840
     gtgggtacag agttagttag agagaaatat gctcctagtg gtaatgttct tcagaccttg       900
     cctaatgggg agccagacct ctttacacaa aagagaatag ctatgacgtg gacggatttc       960
     acctttgtta aggattacaa ggcagcgggg atcgactttg gaatagctcc gtggccagta      1020
     atacgtggtt ccgaatcctt tgtcgacaca tggacggctc catgggggac ttttactgag      1080
     tcagaacatc agcatgctgc gctaacgttc ctcaagttta tggccacaga tgctcaacgg      1140
     atcagaggaa cagtctctgc agatcccccg ctatctttta aggtagctga gcagatgaag      1200
     tggggacaag gagatcccct caaagagcag tacctacaag tgctcaaagt tgcagcgaag      1260
     gcacagcctt ttgttcctcc attgcctgag ggaggttata acccagatga tatatacaac      1320
     aagatgactg ttcagggagt aaaagatgcc aagccactat tagacgatgc tgccaagaga      1380
     actcaacctt tgcttgataa agcatggcaa gagtgggaaa aaatagggag ataa            1434
//

If you have problems or comments...

PBIL Back to PBIL home page