(data stored in ACNUC7421 zone)

EMBL: CP001825.PE125

CP001825.PE125       Location/Qualifiers
FT   CDS_pept        138635..139672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0127"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   sus:Acid_2859 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41049"
FT                   /db_xref="GOA:D1CDP3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP3"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACZ41049.1"
FT                   /translation="MRGVVLPGNRTVDLREFPTPQPGYGQVLVRMKASGICGSDIRAIY
FT                   REWLGTGPEAYKGCIAGHEPCGIVEEVGPGVEHFSPGDRVVVYHIVGCGVCKDCRAGWM
FT                   INCKAPYPYRAAYGWQRDGGHADFLLAEQRTLIKLPDNLTFVDGALAACGLGTGYQAIL
FT                   RAGVSGRDRVAVVGLGPVGLGILMLARASGAEVIGIDVIPERLEMAQKIGAEHTFLSGD
FT                   NTAERIMDLTKGEGVEVVIDASGNPLGRHLCLEIAGEWGRVVFVGEGNTVSFEPSPLLI
FT                   HKQLTLMGSWVCGLVQMEELLGFLSRKELHPEQIVTHKFPLEDADEAYRLFDSGKSGKV
FT                   VITWD"
     atgagagggg ttgttcttcc aggcaacaga accgtcgatc taagagaatt cccaacacca        60
     cagccaggat atggacaagt gctagtaaga atgaaggctt cgggaatttg tggcagcgat       120
     attagagcta tctacagaga atggctaggc acaggaccag aagcttataa aggctgtata       180
     gcaggacatg aaccatgtgg tatcgtggag gaagtaggcc ctggagtaga gcactttagc       240
     ccaggagaca gagtggttgt ctaccacatc gtaggttgtg gagtgtgcaa agattgccgt       300
     gcaggttgga tgataaactg taaagcacct tatccctacc gcgcagctta tggatggcaa       360
     agagacggag gccatgctga cttcctgttg gccgaacaaa gaaccctcat aaagctgcct       420
     gataatctta cattcgttga tggtgcgtta gcagcgtgtg gtcttggaac aggttatcag       480
     gctatactcc gagcaggtgt gtctggtagg gacagagtag cagtggtagg gctaggacct       540
     gtgggtttgg gaatactgat gctcgctaga gcttcaggag cggaggttat aggtatagat       600
     gtgatcccag aacgcttgga gatggcacaa aaaataggcg cagaacacac attcctctca       660
     ggagataaca ctgctgagag gataatggac ctcaccaaag gggaaggggt agaggtagta       720
     atagatgctt ccggtaatcc acttggtagg catctatgtc ttgagatagc aggagagtgg       780
     ggtagggtag tgtttgtagg ggaaggtaat acagtgtcat tcgaacccag cccattgttg       840
     atccataagc aacttactct tatgggctct tgggtgtgcg gcttggtcca gatggaagaa       900
     ctactaggat tcctttccag aaaagagctt catcccgagc aaatagtaac ccataagttc       960
     cctctggaag atgctgacga agcttacagg ctgtttgact cgggcaagtc aggcaaagta      1020
     gtgattactt gggattag                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page