(data stored in ACNUC7421 zone)

EMBL: CP001825.PE126

CP001825.PE126       Location/Qualifiers
FT   CDS_pept        139745..140383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0128"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   aba:Acid345_3130 protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41050"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP4"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ACZ41050.1"
FT                   /translation="MVLARFLPNDERFFEYFRDAATNARDSAALLRDIVETNADIERKV
FT                   RKLRDLEHIGDEITHQVFNALNSTFVTPIDREDIQRLTSELDEFVDYIEEAARRMYLYK
FT                   VGAPTEISKLLVRVIDEQAEILANSIPLLESAKKRDTLLRNTVEIHRLENEGDDILNQA
FT                   MAHIYDDVPDIPSLIKAIRWSELYQLLEDATDRAEDIANALEGIVLKNA"
     atggtacttg ctcgattcct accaaatgat gagaggtttt ttgaatactt ccgagatgct        60
     gcaaccaacg ccagggattc agcagctctc ctgagggaca tagtagaaac taacgcagat       120
     atagagagaa aagtcaggaa gctgcgcgat ttggagcata ttggtgatga gattacccac       180
     caggtgttta acgccctgaa cagtactttt gtaacgccga ttgatagaga agacatacag       240
     agactaacca gcgaactgga tgagttcgtg gactacattg aagaggctgc ccgccggatg       300
     tatctgtata aagtgggagc ccctacggag atctctaaac tgttggtcag ggtgatagat       360
     gaacaagcag agatacttgc taatagcatc ccacttcttg aaagcgctaa gaagagggat       420
     acgttacttc gtaacaccgt agagatacac agactagaaa acgaaggcga cgacatattg       480
     aaccaagcaa tggctcatat atacgatgat gtgccagata taccttcctt gataaaggcc       540
     atacgatgga gtgagttata ccagctgcta gaggatgcta ccgatagggc agaagacata       600
     gccaacgctc tggagggaat agtactaaag aatgcctga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page