(data stored in ACNUC7421 zone)

EMBL: CP001825.PE128

CP001825.PE128       Location/Qualifiers
FT   CDS_pept        141554..142675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU06570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41052"
FT                   /db_xref="InterPro:IPR021416"
FT                   /db_xref="InterPro:IPR023158"
FT                   /db_xref="InterPro:IPR035328"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP6"
FT                   /inference="similar to AA sequence:KEGG:BSU06570"
FT                   /protein_id="ACZ41052.1"
FT                   /translation="MMKTHNLIYTTLVLLLIAFITACGSGSSANENSPTPTTPESSTLQ
FT                   SPSPEPTPTQVASTPPTQMPSPQPTSTPEHKEKRTDKNLLSPRKRPIAIMVENHPDARP
FT                   QSGLINADVIYEAPAEFGIPRFMAIFVNKESKIVGPIRSARTYYVSWASEYNPVYVHAG
FT                   GSPQGIRLIDQLGLQHIDALRYYAPQAFWRSTDRDAPHNLYGSTTEIRKLIAKDKNLQG
FT                   KKGTWGPIHWSNNPTIGSESGKEVSVTYAEGYQASFKYDPQTGLYNRYMVGKPHLDRET
FT                   KRQIAASAVIVQTVDMWQIKGDAYGRREVDLTNASGPILVFQNGKVLKGKWEKEDVDTI
FT                   TKYETNDGKPIELKPGQVWIEIVPKEGSKIDYR"
     atgatgaaaa cgcataatct gatttatact acgttggtcc ttttgctgat agcatttatc        60
     actgcctgtg gtagtggttc cagtgctaat gaaaattcgc caacacccac tacacctgaa       120
     agtagtaccc tacaatcacc ttctccagag ccaacaccca ctcaggttgc gagcactcct       180
     cctacacaga tgccgtcacc acaacccacg tctactccag agcataaaga aaaaagaact       240
     gataagaacc tgctaagccc taggaagaga cccatcgcga taatggttga gaaccatccg       300
     gacgcaaggc cccagtcggg gctcataaat gcagatgtca tatatgaagc ccctgcagaa       360
     tttggtatac ccagattcat ggccatcttc gtaaacaagg aatccaagat agtagggccg       420
     ataagatcgg cacgcaccta ttatgtctcc tgggcatctg aatataaccc tgtctacgta       480
     catgcgggcg gaagcccaca aggcattagg ctaatagacc aactgggact acagcatata       540
     gatgctctca gatactatgc gccccaggca ttctggagaa gcaccgatag agatgcacct       600
     cataatctgt atggaagtac tacagagata cgcaagctaa tagccaaaga caaaaaccta       660
     caaggcaaga agggcacttg ggggccaatc cactggtcaa acaatccaac cataggcagc       720
     gagagtggta aagaagtctc agtgacttac gctgagggat accaggcttc gtttaaatat       780
     gatccacaga ccggtctata taaccgttac atggtaggga agccacatct agatcgtgag       840
     accaagagac agatagctgc atctgcagtt atcgtgcaga cggtcgatat gtggcaaata       900
     aagggcgacg cctatggtag aagggaagtt gatctcacta acgcctcggg cccaatacta       960
     gtattccaga atgggaaagt cctcaagggc aagtgggaaa aagaggatgt agatacgatt      1020
     actaaatatg aaaccaatga tggtaagcct atagagctca agccaggaca ggtctggata      1080
     gagatagtcc ccaaggaagg gagcaagatc gattataggt aa                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page