(data stored in ACNUC7421 zone)

EMBL: CP001825.PE13

CP001825.PE13        Location/Qualifiers
FT   CDS_pept        13450..14691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0014"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 2"
FT                   /note="TIGRFAM: 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   2; PFAM: Beta-ketoacyl synthase; KEGG: bcy:Bcer98_0891
FT                   3-oxoacyl-(acyl carrier protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40937"
FT                   /db_xref="GOA:D1CDD1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD1"
FT                   /inference="protein motif:TFAM:TIGR03150"
FT                   /protein_id="ACZ40937.1"
FT                   /translation="MFDRRVVVTGLGAITPVGNNLEDTWKALVEGRSGISYVTRYDLGD
FT                   IPVKIGGEVKGFDPASVVDPKEARYMSRATVFAIAAADEAIKQAGLQITPENAERVGIY
FT                   MGSGAGGIELLLEQQKVLEQKGPRRVSPYLMPNFIVDSASGHMAIRYGAQGPNMAPVSA
FT                   CATGGHSVGEAYETIRRGDADVMIAGGTEGGSHLPIMFAGFSVIKALANDDPPEKACKP
FT                   FDLNRSGFVLSEGAAVLVLEELEHALSRGAKPLAEIIGYGTGNDAFHMASQPEGGAGAA
FT                   RVMRMAIRKANIAPEEVDYINAHGTGTQINDKGETAAIKEVFGDHAYKLAISSIKSMIG
FT                   HTMGAAGAIEAVACVKTIIEGCIPPTINYETPDPECDLDYVPNTARSADVRVALSNSLG
FT                   LGGHNSCLIFRKFE"
     ttgtttgata gaagggtagt agtaacagga ctaggagcga taacacctgt aggcaacaat        60
     ttagaagata catggaaagc cttagtagaa ggcagatcgg gaatctctta tgtaaccaga       120
     tacgacctgg gcgatatccc agtcaagata ggtggggaag taaagggctt tgatcctgca       180
     tcggtagtag atcccaagga agctcgttac atgtccagag ctactgtttt cgcaatagct       240
     gcagcagacg aagccataaa gcaggcaggg ctgcagatta ctccagaaaa cgccgaacgt       300
     gtaggcattt atatgggtag tggtgcaggt ggtatagaat tgctcctgga gcagcaaaag       360
     gtcttagaac agaaaggtcc cagaagggtt agcccatacc tgatgcccaa cttcattgtg       420
     gactctgcca gcggccacat ggcaataagg tacggagctc aaggacctaa tatggctcca       480
     gtatccgcct gtgcaaccgg aggccactcc gtgggtgagg cctacgagac aatcaggcga       540
     ggagatgctg atgtcatgat agccggaggt actgagggcg gtagtcacct accaattatg       600
     tttgccggct ttagcgtgat caaagcgtta gctaacgatg atcctccaga gaaggcatgt       660
     aaaccattcg acctcaacag atcgggcttc gtgctatccg aaggagcggc agtgctagta       720
     cttgaggagc tggagcatgc tctatcaaga ggtgccaagc ctctggctga gataataggc       780
     tatggcactg gaaacgacgc tttccatatg gcaagccagc ccgagggcgg agcgggcgca       840
     gccagggtaa tgcgcatggc aattcgtaag gccaacatag ctcctgaaga agtcgactat       900
     atcaacgccc atgggacagg cactcagata aacgacaaag gggaaaccgc agccattaag       960
     gaggtgtttg gcgaccacgc ttataagctc gctatcagct ccatcaaatc catgataggg      1020
     cataccatgg gagcggcagg cgcaatagaa gcagtagcat gcgtcaagac tatcatcgaa      1080
     gggtgtatcc cccctacaat aaattatgag acaccggatc ccgaatgtga tcttgattat      1140
     gtccccaaca cagcaagatc tgctgatgta agggtagcac tatctaactc cctagggttg      1200
     ggaggtcata attcctgtct tatctttcga aagttcgagt ag                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page