(data stored in ACNUC7421 zone)

EMBL: CP001825.PE130

CP001825.PE130       Location/Qualifiers
FT   CDS_pept        complement(143142..143444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0132"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: CNX7/SIR5; CNX7/SIR5;
FT                   catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41054"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP8"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ACZ41054.1"
FT                   /translation="MNIAGGSFEIKLLLFAQFREVIGQKELLYKVTIGSTPASVLRSLI
FT                   GEYPDLARLESVTKFIVNEEFVPGDYKLSPGDTLAFIPPVAGGRDDSSDSRSHIH"
     atgaatattg caggaggcag ctttgagata aagctgcttc tttttgctca gtttcgtgag        60
     gtgattggcc aaaaagagct cctttataaa gtgacaattg gctctactcc cgctagcgtg       120
     ctccggtctc ttatagggga gtatcctgat ttggcgaggc tggaatctgt aaccaagttt       180
     atagttaacg aggagttcgt gcctggagat tataaactct cccctggcga tactttggct       240
     tttattccac cagttgctgg aggcagagat gatagcagtg actcaagatc ccatatccat       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page