(data stored in ACNUC7421 zone)

EMBL: CP001825.PE131

CP001825.PE131       Location/Qualifiers
FT   CDS_pept        complement(143445..144812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0133"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="PFAM: glycine cleavage system P-protein; KEGG:
FT                   glo:Glov_2672 glycine dehydrogenase (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41055"
FT                   /db_xref="GOA:D1CDP9"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP9"
FT                   /inference="protein motif:PRIAM:1.4.4.2"
FT                   /protein_id="ACZ41055.1"
FT                   /translation="MPYIPHTDKERQEMLSRIGVNSIDELLTAIPERYKYPQLRIGPGL
FT                   SEAEVAKKVNALSERNLDVDHVACFAGGGAYNHFIPAAVKSVTSRNEFYTSYTPYQAEV
FT                   SQGTLQSIYEFQTMIAALMGMDVANASMYDGATAAAEGALMAVHYTRRPKIVIVPTFHP
FT                   EWVEVIRTFTSGVELEIVVAGELPDNFKSTPRDIATYVDERTACVLVQYPNFFGSIEDI
FT                   KGYADLAHSVGALLVVAAYPIALGLLKPPGELGADIAVGEGQSLGNELNFGGPYLGLFA
FT                   TRKDFIRYMPGRLVGATKDVDGKRGYVLTLQTREQHIRREKATSNICTNEALNALASTV
FT                   YLSLMGKQGLAKVAQLCVNNAHYLAGVLSAVPGWEVVSAEPFFNEFVLKCPVPASQVVS
FT                   ALIDEGILAGIDLGRFDSKLSEYLLVCATEMNTKEEMDRYASLISNVKAVKELERV"
     gtgccctata tacctcatac agacaaagaa aggcaagaga tgctgagccg tataggagtc        60
     aattcgattg acgagctcct aacggccata cctgagagat ataagtatcc tcaactaagg       120
     attggccctg gactatcaga agcagaggtg gccaagaagg taaatgctct atctgagcgg       180
     aatcttgatg tggaccatgt agcctgtttc gcaggtgggg gggcatataa tcatttcatc       240
     ccagctgccg taaagagtgt tacttctcga aatgaattct atacttcgta tactccttat       300
     caggcagaag tgagccaggg aactctccag agcatatatg aatttcagac catgatcgcg       360
     gcacttatgg gaatggacgt ggctaatgcc tccatgtatg atggggccac tgctgctgct       420
     gagggcgctc ttatggcagt gcactatacc cgacggccta agatagttat agtcccaaca       480
     ttccatccgg agtgggtgga agttataaga acttttactt ctggcgtaga gctagagata       540
     gtggtcgctg gagaactgcc cgataacttc aagtctacgc ctcgggatat tgctacttac       600
     gtagatgagc gaactgcttg tgtactggta cagtatccca acttcttcgg aagtatagag       660
     gatataaaag ggtatgctga tcttgctcac tctgttggag ctctccttgt ggtcgctgcc       720
     tatcctatag cactcgggtt actcaagcct ccaggggagc ttggggcaga tatagctgtg       780
     ggggagggac aatctcttgg taatgagctt aacttcggcg gtccatatct tggcctcttt       840
     gcgacacgta aggattttat tcggtacatg ccaggtaggt tagtgggagc tactaaggat       900
     gtggacggta agagaggtta tgttcttacc ctgcagacta gagagcaaca cataaggaga       960
     gagaaggcta caagtaatat atgtactaat gaagctttga atgctttggc ttccacagta      1020
     tacctttctc tgatggggaa acaggggctt gcaaaggtgg cccagctatg cgttaacaac      1080
     gcccactatt tggccggtgt gctgagcgct gtgccgggat gggaggttgt aagcgcagag      1140
     cccttcttca atgagtttgt tctcaagtgt ccagtaccag cttcgcaagt ggtatctgct      1200
     cttattgacg aagggatact ggcagggata gatctaggaa ggtttgattc caagctaagt      1260
     gagtatctat tagtatgtgc cactgaaatg aacaccaagg aagagatgga tagatatgcc      1320
     agcttgatat ctaatgtgaa ggctgttaag gagttggaga gagtatag                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page