(data stored in ACNUC7421 zone)

EMBL: CP001825.PE133

CP001825.PE133       Location/Qualifiers
FT   CDS_pept        complement(145483..146241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0135"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sus:Acid_1840 beta-lactamase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41057"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACZ41057.1"
FT                   /translation="MSVKLTFLGTGASFGVPMLGCKCRVCRSNNPRNKRTRTSALISFD
FT                   GHNILIDASPDFRCQALINNVDSLDAVLFTHSHADHTFGIDDLRAFSLREPITCYGDES
FT                   TVEAIRRRFDYIFSPTPHLGSRPKLRLHSIKNNFRVSGLEFVPLPIRHGLDCITAYMFE
FT                   GIAYITDASEIPEVTLQRIKSVDVLVLNALRFEPHAMHLGLWQAVDLAKTVGAERTYLV
FT                   HLGHDLDYDEVSSMLPDGVQLAYDGLQIEV"
     atgtctgtga agcttacttt tttaggtacg ggcgctagct ttggcgtccc tatgctgggg        60
     tgcaagtgcc gtgtctgtag atcaaataac cccaggaata agcgtactag aacgtcagcg       120
     ctgataagct ttgacgggca taacatactt atagatgcct cgcctgattt tagatgccaa       180
     gctctaatta ataatgtgga ctctttagat gcagttttgt tcacgcactc ccacgcagac       240
     cacacttttg gcatagatga tcttagggcc tttagcctta gagagcctat aacctgctat       300
     ggggatgaga gtactgtaga agcgataagg cgacgttttg attatatatt tagtccgaca       360
     cctcaccttg gttcgaggcc gaagttaagg cttcattcta taaaaaacaa ctttcgagtt       420
     agcggtttgg agtttgtccc tttgcctata aggcatggtt tggattgtat aaccgcctat       480
     atgttcgaag gcatagctta cataactgat gcgagcgaga tcccagaggt tactctccaa       540
     aggataaaaa gtgtagatgt gcttgtattg aatgctttga ggtttgaacc tcatgctatg       600
     catcttggcc tgtggcaggc ggtagattta gctaagactg ttggagctga acgtacttac       660
     ctggtgcatc tagggcacga cctagactat gacgaggtta gctcaatgct tcctgatgga       720
     gtacaactgg cttacgatgg cctacagatt gaggtctaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page