(data stored in ACNUC7421 zone)

EMBL: CP001825.PE136

CP001825.PE136       Location/Qualifiers
FT   CDS_pept        149220..150176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0138"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.144"
FT                   /note="KEGG: bcz:BCZK1642 tagatose-6-phosphate kinase,
FT                   phosphofructokinase I; TIGRFAM: 1-phosphofructokinase;
FT                   PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41060"
FT                   /db_xref="GOA:D1CDQ4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ4"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ACZ41060.1"
FT                   /translation="MKALTVTLNAAIDITYALPYLQPGESLRVHEKIYSPGGKGNNVAK
FT                   ILNILGDDVIATGFVGGYTGQFIEESLQSIGIVPKFVKTRDASRLCIAVIEEANGRVSE
FT                   LLEPGANITRDESDKLLELVKQLATEVDTVVFSGSLPKGVPDDYYRILLSQLKGLNVQT
FT                   VLDTSGESLRLGIRGKPNIIKPNRKEIQDLMGRDAPVKEIIAFCRQELLAKYLSTDAIV
FT                   LLTLGKDGAILLTKELVLQAIPPDIKVVNPVGAGDALLAGFLHAQSVWKDPDLMLKYAV
FT                   AVGTASALQKTAGSVNPQDIDLIMSQVNVRTLLLGAE"
     atgaaagctc tgactgtaac acttaatgca gccatagata taacttatgc tctgccttac        60
     ctacagccag gcgagtcatt gcgcgtacac gagaagatct actcccctgg tggtaaaggc       120
     aacaatgtgg ccaagatcct aaatattctt ggtgatgatg taatagccac aggatttgta       180
     gggggatata cgggtcagtt catagaagag tctttgcaat ctataggcat agtgcccaag       240
     tttgtaaaaa ccagagatgc ttccagactg tgcatagcag taatcgagga agcaaacggc       300
     cgggtatcag agctgctgga gccaggagca aatattacca gggacgaatc tgacaagctc       360
     ttagagctgg ttaagcaact ggcaacagag gtggatacag tagtattctc gggtagcttg       420
     cccaagggag ttccagacga ctactacagg atcctgttat cacagctcaa gggcttgaat       480
     gtgcagacgg ttctagatac cagtggagaa tccctacggt tgggtataag agggaagcct       540
     aacatcataa agcccaatag aaaagagata caagatctga tgggtagaga tgccccagta       600
     aaagagataa tagctttctg caggcaagaa ttgctagcta agtacctatc cacagatgca       660
     atagtattgc taacgctagg gaaggacggt gccatattgc taacaaaaga gcttgtgctg       720
     caagcaatac ctcctgatat aaaggtagta aacccagtcg gggcaggtga cgcactgcta       780
     gcaggttttt tgcatgctca gtctgtatgg aaagaccctg atctgatgct aaagtatgct       840
     gtagcggtag ggacagcctc agctctacaa aagaccgcag gaagtgtaaa cccgcaagat       900
     atagacctaa taatgtctca ggtaaatgtt agaacacttt tattaggagc agaataa          957
//

If you have problems or comments...

PBIL Back to PBIL home page