(data stored in ACNUC7421 zone)

EMBL: CP001825.PE137

CP001825.PE137       Location/Qualifiers
FT   CDS_pept        150177..151241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0139"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: rlt:Rleg2_4761
FT                   sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41061"
FT                   /db_xref="GOA:D1CDQ5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ5"
FT                   /inference="protein motif:PRIAM:2.6.1.16"
FT                   /protein_id="ACZ41061.1"
FT                   /translation="MLETSTAHSHTYNEITNQPVSWKTTVDAISSQWAELQPQLTITPD
FT                   THYVFVGCGTSLYIAQSAAQCFQEITGYTSLAVPGSEVFLSAKSTVPSRYPVIAFIISR
FT                   SGTTTEALLAADYLAANRSNVTTIGITCNSDTELTKRTRFSIQLPHAHEESVVMTQSFT
FT                   SMLIALQYVAASLAGDQMVIDQISSLSTYLQRDIRSFESKAQELGENLNLDHFVYLGLG
FT                   PNYGLAQEGNLKLKEMTQVHCEAYNPLEFRHGPISTVREGSAIILLAGNRERDYVPSLV
FT                   TDLKEVGAFVASCSPYPIDGSDMHLLVGKELTDVPRCALYMPFLQYLAYYRAVSLGLNP
FT                   DQPRNLSQVVKLDE"
     gtgttagaaa caagcacagc acactctcat acctataacg agatcactaa tcagcccgtc        60
     tcctggaaga caaccgttga cgcaatatct tcacaatggg ccgagttgca gcctcagctg       120
     acgataaccc cggatactca ttatgtattc gtaggatgtg gcacatctct gtatatagct       180
     cagagtgcag ctcagtgttt tcaggagata actggctata catcattagc tgtgcccggc       240
     tccgaagtgt tcctgtccgc caaatctact gtaccttcca gatatccggt aatagctttc       300
     ataatctctc gttctggtac aaccaccgaa gcattacttg cggctgacta tctggctgct       360
     aacagatcaa acgtaactac aattgggata acctgcaaca gtgatactga gcttaccaag       420
     aggactagat ttagcattca acttcctcat gcacacgagg aatcagtagt tatgactcaa       480
     tcattcacct cgatgctgat agctttgcag tacgtagctg catccctagc aggagatcag       540
     atggtcatag accagatctc ctccttgagc acctacctac agagagacat caggagtttt       600
     gaatccaaag cacaggagct aggggagaat ttaaacctag atcattttgt gtatctaggg       660
     ctcggcccca actatggcct cgctcaggag ggcaacctaa agcttaagga gatgacccag       720
     gtccactgcg aggcttacaa tccgctggag ttcaggcatg gtccaatatc aacagtaaga       780
     gaaggctctg caataatcct gcttgccggc aacagagaaa gagattacgt accgtcatta       840
     gtaactgatc ttaaggaagt aggtgctttc gtcgcatctt gctctcctta tcccatcgat       900
     ggatctgata tgcacctgct cgtggggaag gagctaacag atgtacccag atgtgcgctc       960
     tacatgccat tcctgcaata cctggcttac tacagggcag tttcattggg attaaatcca      1020
     gatcagccga gaaacctttc gcaggtagta aaactggatg aatag                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page