(data stored in ACNUC7421 zone)

EMBL: CP001825.PE138

CP001825.PE138       Location/Qualifiers
FT   CDS_pept        151234..152214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0140"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: smd:Smed_4553 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41062"
FT                   /db_xref="GOA:D1CDQ6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ6"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACZ41062.1"
FT                   /translation="MNSKLSRPLAIVGNLNVDLWVRTVSRFPRWDEELVVDSAQMVLAG
FT                   TAGYIMLAAKGLGIPTFTISTIGNDAFGRFLLEEMKNHGLSCEGVIVMEGEETSLGIIF
FT                   VGDKGQRGILSTLGAHSKMDLTLVRSRDSLISSCEEIFLCGNYLLPLMSPSHIQDFAKE
FT                   LQERGQIVFFDPSWDPSGWTDVTRKSTYSLLQHVDVYLPNQEELLHLTAKNSLDEALQE
FT                   IRPRIAGEAVIKMGERGALYINKSEEIYFEGFRVEAVNTVGAGDVFDLGYLYARRCGWP
FT                   PYQRLQFACALAAMVISQHRDRQYPKLSEVLNFLQKKTHDNFWDF"
     atgaatagta agctctcaag gccattagca atagttggta atctgaacgt cgatctttgg        60
     gtaagaacgg ttagccgttt ccctagatgg gacgaagagc tcgtagttga ttccgcccaa       120
     atggttcttg caggtaccgc cggctatatc atgctcgcgg caaaggggct aggaatccct       180
     acatttacca tatctaccat aggaaatgac gcatttgggc gttttctatt agaagagatg       240
     aagaatcacg ggctatcctg cgaaggtgtg atcgtaatgg aaggggaaga aacttcccta       300
     gggatcatat tcgtcgggga caaagggcag aggggaatac tatccacact gggagcccac       360
     agcaagatgg acctaacctt agttagaagt cgtgactctc ttatatcttc ttgtgaagag       420
     atcttcctct gtggtaacta tctgttacct ctgatgtccc cttcgcacat tcaagatttc       480
     gctaaggagt tgcaagagcg aggacaaatt gtattctttg atcctagctg ggatcctagt       540
     gggtggacag atgttacaag gaaaagtact tactccctct tacaacacgt agatgtttat       600
     ttacccaacc aggaggaact cctacacctt acagctaaga atagtttaga tgaggcatta       660
     caagaaatac gacccaggat cgcaggcgaa gccgttatca agatgggaga aagaggagct       720
     ctatatataa acaagagcga agagatctat tttgaaggct ttagagttga agctgtaaac       780
     acggtggggg caggggatgt ttttgatcta ggatacttgt atgctcgaag gtgtggttgg       840
     ccgccttacc aaaggttaca gttcgcgtgc gctcttgccg caatggtcat atcacaacat       900
     agagaccgcc aatacccgaa gctatcagag gtgctcaact ttcttcaaaa gaaaactcat       960
     gataacttct gggactttta g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page