(data stored in ACNUC7421 zone)

EMBL: CP001825.PE139

CP001825.PE139       Location/Qualifiers
FT   CDS_pept        complement(152221..152655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0141"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   sus:Acid_2826 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41063"
FT                   /db_xref="GOA:D1CDQ7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ7"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ACZ41063.1"
FT                   /translation="MGTETKCKFCLISSGESNAKIVYANDFCLGFLDIRPVFPGHVLVI
FT                   PRKHYVTLPDLPNDLVLPLFKAVRTLSEAIPKAMEAEGTFVGINNKISQSVPHLHVHVV
FT                   PRRRGDGLRGFFWPRQKYPNEAAMEEVARKIREAVDAIVN"
     atgggaacag aaaccaaatg caaattctgt cttataagca gtggcgaatc caatgctaag        60
     atagtgtatg ctaatgattt ctgccttgga tttcttgata taaggcctgt tttcccaggg       120
     cacgtattag tcattcctag aaagcattat gttactctgc cagatctgcc taacgatctt       180
     gtattacctt tattcaaagc cgtgagaacc ctttctgagg ctatacctaa ggcgatggag       240
     gctgagggga ccttcgtggg aataaacaac aaaattagcc agagcgttcc acatctgcac       300
     gtacacgtcg ttcctagaag gagaggagat gggcttagag gcttcttctg gcccaggcaa       360
     aagtatccga acgaagcagc tatggaagaa gtagccagga agataaggga agcggtagac       420
     gcgattgtaa actga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page