(data stored in ACNUC7421 zone)

EMBL: CP001825.PE14

CP001825.PE14        Location/Qualifiers
FT   CDS_pept        complement(14871..16175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0015"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   SMART: CBS domain containing protein; KEGG:
FT                   afw:Anae109_2181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40938"
FT                   /db_xref="GOA:D1CDD2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD2"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACZ40938.1"
FT                   /translation="MSGSLWLSGLVGVCLFCLLVFSSMADAALRALNQVRLRALIEQGF
FT                   GRAEAMDRLLEYPHRITATTLIINTFALAGLSALTAILALQLSNNGAQWWLITLTIIVL
FT                   ALFVLIFGQLVPRSLAIRRPERTALRITRMLSVAYFFISPIARVAEWVTNTFLGIFGVK
FT                   DMPRNPFITEDDLRMLVNAGEEEGVIEQEERDMIAGILRFGDIAAHEVMVPRPDIVAVD
FT                   VNTDLRTALDLALEKGHSRLPVYEESLDNVVGIVYLKDLARAIVSSSNVSLRDLARPAV
FT                   FIPESKRLGELLQEFQSSKVHMAIVVDEYGGTAGLITIEDILEEIVGEIQDEYDVELPD
FT                   IEKISEDEWIIRAKIDLDDVNELLGIHLPAEEYDTLGGFITAQLERLPVPGDEVEVEGV
FT                   LMKVLDIEKRRVGRVLVKRLPVPTTSENQEEADES"
     gtgagcggct cattatggct ttctggccta gtgggtgtgt gtttgttctg cctacttgtg        60
     ttttcatcta tggctgatgc agcattgcgc gcgctaaacc aggtaaggtt aagggcgctg       120
     atcgagcagg gcttcggtag agcagaggct atggataggc tgctggagta tccgcatagg       180
     atcacagcaa cgaccctcat aatcaacact tttgcattgg cgggattatc agccctcacg       240
     gctatcctcg cgcttcagtt gtcaaacaat ggtgctcagt ggtggttgat aactcttact       300
     attatcgtgc tagctctctt tgtgcttatc tttggtcagc ttgtccctag atctctagct       360
     attagaagac ctgagaggac agctctgcgt atcacccgta tgctgagtgt agcgtatttc       420
     ttcataagcc cgattgcacg agtagcagag tgggtgacca atacctttct gggtatcttc       480
     ggtgtaaagg atatgcctcg caacccattc atcactgaag atgacctgcg tatgctggtg       540
     aatgcgggtg aagaggaagg cgtgatagag caggaagaac gcgatatgat agctggtatc       600
     ctgaggttcg gggatatagc tgcccatgag gtgatggttc caaggccaga tatagtagct       660
     gtggacgtca atacagatct caggacggcg cttgaccttg cgttggagaa gggccactct       720
     cgactaccag tttacgagga gagtctcgac aatgtggtgg gcatagtata tctgaaggac       780
     ttggcaaggg cgattgtatc ctctagcaac gtgagtctcc gcgacttggc caggccagcc       840
     gtgtttatcc ctgagagcaa gaggctgggt gagctattgc aggaatttca gagcagcaag       900
     gtacacatgg cgatcgtggt ggatgagtac ggtggtaccg cggggctaat tactatagaa       960
     gatattcttg aggagatagt gggtgagata caggatgagt atgatgtcga gcttccagat      1020
     atagagaaga tatctgagga tgaatggata atccgggcga agatcgatct ggatgatgtt      1080
     aatgagctat tagggatcca tctgccggca gaagagtacg acacgcttgg aggttttatt      1140
     actgcccagc tcgagagact gccagtgccc ggtgatgagg tggaagtgga aggcgtactg      1200
     atgaaggtgc ttgatataga gaagagaagg gtggggaggg tactcgtgaa gaggctgcca      1260
     gtgcctacca cctccgaaaa ccaggaagaa gctgatgagt cttaa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page