(data stored in ACNUC7421 zone)

EMBL: CP001825.PE143

CP001825.PE143       Location/Qualifiers
FT   CDS_pept        154903..155517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0145"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /note="TIGRFAM: D,D-heptose 1,7-bisphosphate phosphatase;
FT                   histidinol-phosphate phosphatase family protein; hydrolase,
FT                   HAD-superfamily, subfamily IIIA; PFAM: Polynucleotide
FT                   kinase 3 phosphatase central region; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: D,D-heptose
FT                   1,7-bisphosphate phosphatase; K03273
FT                   D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41067"
FT                   /db_xref="GOA:D1CDR1"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR1"
FT                   /inference="protein motif:TFAM:TIGR00213"
FT                   /protein_id="ACZ41067.1"
FT                   /translation="MGNKAVFLDRDGTLVHPRHYPSRAEDLVLYRGLPEEMRILQQMGF
FT                   KLVVITNQGGIAHGYFTERDLELMHTSLQDQLSEFGVRIDAFYYCPHHPEGNLAHLACE
FT                   CECRKPKPGMILQAAKDMNLDLSSSWMVGDILNDVEAGRKAGCKTILVDLGTESKPSSP
FT                   DRTPDYVARTTKHALQIIQSLEGQRKDVDLDYIPSSWKAAV"
     atgggcaata aagcagtatt tctagaccgt gatggcacgc tagtacatcc aagacattat        60
     ccttccagag cagaggacct agtactctac cgaggcttgc cggaagagat gcgaatccta       120
     cagcaaatgg gattcaaact agttgtaatc accaaccaag gaggcatagc tcatggctac       180
     ttcacggagc gggacctaga actcatgcac actagcctcc aagatcagct ctctgagttt       240
     ggagtgcgta tagatgcttt ctactactgt ccgcaccatc cagagggaaa cttagcccat       300
     ctggcttgtg aatgcgaatg caggaaacca aaaccaggaa tgatattgca ggccgccaaa       360
     gatatgaatt tggacctgtc gtcgtcatgg atggtaggcg acatactcaa cgatgtagag       420
     gcgggcagaa aagctggctg caagactatc ttggtagacc tcggtactga gtctaagcct       480
     agcagtccgg atagaactcc tgattatgtc gcaagaacca caaagcatgc cctccagatc       540
     atccaaagcc tggaggggca aagaaaagac gtcgatcttg actacattcc ttcttcctgg       600
     aaggcagctg tgtag                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page