(data stored in ACNUC7421 zone)

EMBL: CP001825.PE144

CP001825.PE144       Location/Qualifiers
FT   CDS_pept        155545..157032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0146"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /note="TIGRFAM: cytidyltransferase-related domain protein;
FT                   PFAM: PfkB domain protein; cytidylyltransferase; KEGG:
FT                   nmu:Nmul_A1792 bifunctional ADP-heptose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41068"
FT                   /db_xref="GOA:D1CDR2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR2"
FT                   /inference="protein motif:TFAM:TIGR00125"
FT                   /protein_id="ACZ41068.1"
FT                   /translation="MLKVDIVNNFHKVRALVIGDAMLDSYLEGTASRLCSEGPVPVVTK
FT                   SGEERVPGGAANTASNLRALGAQVMFLGFVGRDANAAYLRTALRRYDIDDGWLVEDPNI
FT                   STIHKMRILADEQYVVRFDEGDTTNYSKSSREELLYKLEQALTKCDVIVVSDYSYGAVS
FT                   EDVTSVIKDFRRTQDIPLLVDSKNIISYGKASATLITPNHHEARAAVGRPASIKPPDIE
FT                   EMMGIGKQLLDCMDCQFIAITMASEGVLLLGQKAEPLHIPAYPIPKASVAGAGDSFLAA
FT                   TALSLAVGADIAEATRIGVENARLAVLKRRTAVVEHRELLLRMSTLDRQSDQPYESLIA
FT                   ELEAARREGKVIVMVNGVFDLLHAGHVNLLRKAKELGDLLVVAINSDKSARRLKGPNRP
FT                   INDERHRLELVASLEPVDHVVLFDEDTPIQLIKTIRPHVLVKGADYEGQEIPEAPILQD
FT                   IGTKLVLVPLTENYSTSSLIERILSSAPNQQLTSEVM"
     atgctgaaag tagacattgt aaacaacttc cataaagtta gggcgctggt aattggagac        60
     gcgatgctcg acagctacct agagggcaca gcaagcaggc tatgttccga gggcccagtg       120
     ccggtagtaa ctaaaagtgg agaggaaagg gtccctgggg gagctgccaa tactgcttca       180
     aacctcagag ctcttggagc gcaggttatg tttctaggat ttgtgggcag agacgcaaat       240
     gctgcctacc tcaggactgc ccttagaaga tacgacatcg acgatgggtg gctggtagag       300
     gaccctaata tttccaccat acacaagatg aggatattag cagacgagca gtacgtggtc       360
     aggttcgacg agggcgacac gaccaattac tcgaaatcct ccagggagga gctactatac       420
     aagttggagc aagcactaac gaagtgcgac gtaattgtag tatcagacta cagctatgga       480
     gctgtatctg aagatgtaac atcagtaata aaggactttc gcaggaccca agatataccc       540
     ctcctggtcg attccaagaa cattatttca tacggcaagg ctagcgcgac cttgataacg       600
     cccaaccatc atgaagctcg agctgctgtt ggtcgaccag caagtatcaa gcctcctgat       660
     attgaggaaa tgatgggtat aggcaaacaa ctccttgact gcatggattg tcaatttata       720
     gccatcacaa tggccagcga gggagtacta ctgttggggc aaaaagccga acctctccat       780
     ataccggcct accctattcc caaagccagc gttgctggtg caggggattc tttcctggca       840
     gcaacagctt tgtcgcttgc tgtaggggct gatattgcag aggctactcg cataggggtc       900
     gagaacgcta ggctggctgt gctcaagcgg aggactgccg tagtagaaca tagagaactc       960
     ctccttagga tgagcactct agatagacaa agcgaccagc catatgaatc tcttatcgca      1020
     gagctggagg cagcacgtag agaaggcaaa gtcatagtta tggtcaatgg ggttttcgac      1080
     ctgctccacg ctggacatgt aaacctgctt aggaaagcca aagagcttgg tgatctattg      1140
     gtagtagcca tcaactccga taaaagcgct cgcagactca aaggtcctaa caggccaata      1200
     aacgatgaaa gacaccggct ggagcttgta gcttcgctag agccagtaga ccatgtagtg      1260
     ctcttcgacg aggacacccc tatacaactg atcaagacga ttaggcctca tgtgcttgtc      1320
     aaaggggcgg actacgaggg acaggagatt ccagaagctc caatacttca ggatataggt      1380
     actaagcttg ttttagttcc tctcacggaa aattacagta catccagctt gatagaaaga      1440
     atcctcagtt ctgctcccaa tcaacaacta acaagcgagg tcatgtag                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page