(data stored in ACNUC7421 zone)

EMBL: CP001825.PE145

CP001825.PE145       Location/Qualifiers
FT   CDS_pept        157035..158120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0147"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   tbd:Tbd_0742 ADP-heptose--LPS heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41069"
FT                   /db_xref="GOA:D1CDR3"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR3"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ACZ41069.1"
FT                   /translation="MSIDWLQAKRILIVRLDNLGDVVLATPAIRAIKETLPECQITLLA
FT                   SPVGAQVAEVNPDIDSVIIYSAPWMDPWQRLPQDSAREMKIIEQIRNHKFDGAIIFTSY
FT                   HQSPLPAAYLCYLADVPLRLGSTSDGAGSLLTTRHKPPTTLIHEVERGLELVSAVGFSG
FT                   TQDDLVIEVPSAFRRAVRGWLEDMSIKSPESPLVVIHPGCSMPARTYPWQSYAQVADLI
FT                   KIEMGAEVVFTGAETELDLLTHIKSRMATEPKLFYGRSLPELCALIEHADLVITNNTGP
FT                   MHLAAALKTPVVALFALTNPPEQWRPWKVPHKLLFHEVDCRICYSRICPFEHECLAPVS
FT                   PQEVLQASIDLLQGSAQRRIA"
     gtgagtatag attggcttca agccaagaga atactaatcg tgaggctgga taaccttgga        60
     gatgtggtcc tggccactcc tgcgataaga gcgatcaagg aaactttacc tgaatgtcaa       120
     attactctcc tggccagccc agtaggagca caggtagccg aagtcaaccc agatatagat       180
     tccgtgatca tctatagcgc accatggatg gacccctggc agagactacc tcaagacagt       240
     gcacgagaga tgaagataat agagcagata agaaaccaca agttcgatgg agcgataatc       300
     ttcacctctt atcatcaaag ccctttgcct gctgcctact tgtgctacct ggcagatgta       360
     cccctcaggc tcggatccac tagcgacggg gcagggtccc tgctcactac caggcataag       420
     ccaccaacaa cgcttataca cgaggtggag agaggactcg agcttgtatc agccgtagga       480
     ttttcgggca cccaagatga tctggtaata gaagttccct ctgcatttag acgtgcagtc       540
     cgtggatggc ttgaagatat gtcgataaag tctccagaat caccactcgt agtgattcat       600
     ccaggctgca gtatgcctgc acgcacgtac ccatggcagt cctatgcgca agtagctgat       660
     ctcatcaaga ttgagatggg agcagaagtt gtctttactg gagcagaaac agagctggac       720
     ttgcttacac atatcaagag ccgcatggca acagaaccta agctcttcta tggcagaagt       780
     ctgcctgaac tttgtgcatt gatcgaacat gcagatctgg tcattaccaa caatactgga       840
     ccgatgcact tagcagcggc tctaaagaca cctgtagtag ccctattcgc attgaccaac       900
     cctccagagc agtggcgtcc ttggaaagtt cctcataagc ttctattcca cgaggttgac       960
     tgtcgcatct gctactctcg catatgtccc tttgagcatg agtgtctcgc cccggtgtcg      1020
     cctcaagaag tactacaggc ttcgatagat ctgctacaag ggtcagccca aaggaggatc      1080
     gcatga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page