(data stored in ACNUC7421 zone)

EMBL: CP001825.PE147

CP001825.PE147       Location/Qualifiers
FT   CDS_pept        159182..160240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0149"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   bam:Bamb_5648 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41071"
FT                   /db_xref="GOA:D1CDR5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR5"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ACZ41071.1"
FT                   /translation="MNHPVALDNIEKIAIFRALFLGDLFFTLPAFRALRERFPNAEITL
FT                   IGLPWAKEFVSRFRHYLDRFLEFPGYPGIIEVDVNPTRTQEFLIQARDYGYDLAIQMQG
FT                   NGTTSNGFVAELGARISLGHAVNGDDRLTISIPFTERPIKNEILRWLDLVSLLGAHSTP
FT                   DLEFPIYPHERARAEELIRPALYNNGPIVGMHMGAKEDIRRWPAQRFGELAKILVKLFD
FT                   ATIVLTGTSQEIGLSKEVEAAVGSNVVNLIGKTDLGTFAAVVSSMDLLVTNDTGASHIA
FT                   AATSTPSVVLFGPTTPEQFGPINQDLHKAVKAYEHVQSYSGSPLWELPVEPVLDACIYM
FT                   LQNYYVKPSTAF"
     atgaatcatc cagttgcact cgacaacata gagaaaatag cgatattcag agcgttgttt        60
     ctaggcgatc tgttctttac tttacctgca ttccgagcac taagggagag gttcccaaac       120
     gctgaaataa cccttatagg attgccctgg gcaaaagagt tcgtatctag attcagacat       180
     tatctggacc ggttcctcga gttcccagga tatccaggca tcattgaggt ggatgttaat       240
     cccaccagaa ctcaagaatt tcttatacag gccagagact acggctacga cctggctatc       300
     cagatgcaag gcaatggaac aaccagcaac ggtttcgttg ccgaattagg tgccagaata       360
     agcctaggac atgccgtcaa tggagacgac agactgacga taagtatccc ttttaccgag       420
     agaccaatca aaaatgagat attgcgatgg ctagatctcg taagcctgct aggtgcacac       480
     agcacgccag acctggagtt ccctatatat ccacacgaaa gagctcgagc cgaagagcta       540
     atccggcccg ccctgtataa caacggtccc atagtcggca tgcacatggg tgctaaagaa       600
     gacatcagga ggtggccggc acagaggttt ggagagttgg caaagatcct agtcaagctt       660
     tttgatgcca ccatagtact tactggaact tcccaggaaa tagggctttc aaaggaagta       720
     gaagcagctg ttggaagcaa cgtagtcaat cttataggca aaacagattt agggactttc       780
     gcagcggtag tatcctcgat ggatcttcta gttaccaacg acacaggagc ctcacatata       840
     gcagcagcca ctagcacacc cagcgtagtc ctatttgggc ccaccacacc tgagcaattc       900
     gggcccataa accaggatct acataaggca gtgaaagctt atgagcacgt gcaatcctac       960
     agtggtagtc ctctatggga gctaccggtt gaaccagtgc tggatgcatg tatctacatg      1020
     ctccagaact actacgtaaa accatctaca gcattttga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page