(data stored in ACNUC7421 zone)

EMBL: CP001825.PE148

CP001825.PE148       Location/Qualifiers
FT   CDS_pept        160254..161198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0150"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tbd:Tbd_0743 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41072"
FT                   /db_xref="GOA:D1CDR6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACZ41072.1"
FT                   /translation="MRRYKILCWHIHGSYLDALAQIDQDWYLPVTPDRGEGYGGRRPGM
FT                   PPYVREVPAEEVRNLDLDIIICQTPKNFYEDIPAILSPEQQKLPKIYLEHNCPRQHPTD
FT                   TKHPIDDPNVLLVHVTHFNNLMWDSGRTPTMVIEHSVAIDPSIEYVGDRDKGITVINEM
FT                   KRRGRISGYDIFCKARESVPLDTCGIKSEEIGGLGDIKYRDLHRLMARYRFLFSPMRYT
FT                   SLPLAVIEAMTIGMPVIALATTELPTMIQNDYNGYVSCDVEFLIDRMLFLLNNPKEAKR
FT                   LGQNAKCTAQERFNLDRFRRDWNKAFDLVAGGL"
     atgcgtagat acaaaatact ttgttggcac atacatggta gctatctgga cgctttggca        60
     caaatagacc aagattggta ccttccagta acacctgaca gaggtgaagg ctatggtggt       120
     agacgtccag gaatgcctcc atatgtacgc gaggtaccag cagaagaagt taggaacctg       180
     gacttggaca taataatatg ccagactccc aaaaactttt acgaagatat ccctgcgata       240
     cttagccccg aacaacaaaa gttacctaag atctacctag aacacaactg tccgcgccag       300
     catcccactg atacgaagca tcccatagac gaccctaatg tccttttggt acatgtaacc       360
     cacttcaaca accttatgtg ggatagcggt agaacgccca ctatggttat tgagcacagc       420
     gtggctatcg acccctccat agagtatgtt ggcgaccgag ataaaggtat aaccgtaatc       480
     aacgagatga aacgccgtgg acgtatctcg ggctacgaca tcttctgcaa ggctcgtgaa       540
     agcgttcctt tggacacttg tggcataaag agcgaggaga taggcggact aggggacatc       600
     aagtaccgag atctgcatcg cttgatggca agatatcgct ttctgttcag tcccatgagg       660
     tacaccagct tgccactggc ggtaatagaa gccatgacca taggtatgcc tgtgatagca       720
     ctggccacca cggaactacc tactatgata cagaacgact acaacggcta cgtatcttgt       780
     gacgtcgagt tccttataga cagaatgcta ttccttttga acaatcccaa agaggcaaaa       840
     agactggggc agaatgcaaa gtgcactgca caggagagat tcaacttaga taggttcagg       900
     agggattgga ataaagcctt cgatctggta gctggaggtc tatga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page