(data stored in ACNUC7421 zone)

EMBL: CP001825.PE15

CP001825.PE15        Location/Qualifiers
FT   CDS_pept        complement(16288..17238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0016"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: bcy:Bcer98_0045 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40939"
FT                   /db_xref="GOA:D1CDD3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD3"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACZ40939.1"
FT                   /translation="MNRLRIFTGNANRKLACDIARNLDIEIGDALVTTFKNGETRVRLE
FT                   ENVRGCDVFIIQSTSMPVDHHIMELLLMIDAARRASASRITAVIPYYGYAKQEKKTTGR
FT                   EPISAKLVANIIMQAGADRVLAVDLHAPAIEGFFDIPVDHLRAAPLLVDYYKRNPLPDA
FT                   VVVSPDPGGVLRANDFRFRLGVPLAIIAKQRPRPDTAEVLDMVGDVQGKNAIIVDDLIG
FT                   TGGTLAKAADMLLSRGAKSVHAVATHAAFVGSPAAEEVKKILEGNTIEKIVVTDTIYIP
FT                   PEEVDSKIEIVSVASLLAEAIMRIHKDLSVSELFR"
     atgaatcgct tgcgcatctt tactggtaat gcaaacagga agctggcctg cgatatcgcc        60
     cgcaacctcg atatagagat cggagatgcg cttgtaacca ccttcaaaaa tggtgaaacg       120
     agggtaaggc ttgaggagaa cgtccgaggg tgcgacgtat ttataatcca gagtacctca       180
     atgcctgtcg atcaccatat tatggaactc ctgctgatga tagatgctgc tcgcagggca       240
     tccgcaagca ggatcaccgc agtcatccca tactatggtt acgccaagca agagaagaag       300
     actactggtc gcgagcccat atccgctaag ttagtggcta acatcatcat gcaagctggg       360
     gcggatagag ttttggcagt agatctgcat gcgcccgcaa tagagggttt cttcgatatt       420
     ccagtggacc acttgcgtgc tgctccgttg ctggtcgact attacaagag aaatcctctc       480
     cccgatgctg tagtggtgtc tccagatcct ggtggggtgc tgagggctaa tgatttcagg       540
     ttcaggcttg gtgtgcccct tgcgataatc gctaagcaac gtcctaggcc cgacaccgcc       600
     gaagtgctag atatggtggg ggatgtgcag ggcaagaatg ccattatcgt ggacgatcta       660
     atcggtactg gtggtacctt ggcaaaggct gccgatatgc tcctttctag aggcgccaag       720
     tcggtgcatg ctgttgccac ccatgcagct tttgtaggat caccagctgc cgaggaggtg       780
     aagaagatcc tagaaggcaa tactatagag aagatagtag tgactgatac gatatacata       840
     ccgccagagg aagttgattc caagatcgag atagtatcgg tagcatctct gctggcagag       900
     gctatcatga ggattcacaa agatctctct gtcagcgagc tatttcgata a                951
//

If you have problems or comments...

PBIL Back to PBIL home page