(data stored in ACNUC7421 zone)

EMBL: CP001825.PE151

CP001825.PE151       Location/Qualifiers
FT   CDS_pept        163262..164305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0153"
FT                   /product="GHMP kinase"
FT                   /note="PFAM: GHMP kinase; GHMP kinase domain protein; KEGG:
FT                   sus:Acid_0418 GHMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41075"
FT                   /db_xref="GOA:D1CDR9"
FT                   /db_xref="InterPro:IPR001174"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014606"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR9"
FT                   /inference="protein motif:PFAM:PF00288"
FT                   /protein_id="ACZ41075.1"
FT                   /translation="MQETIFSRAPFRISFAGGGTDLPEYYEKYEGVVLSTAIDKYCYTI
FT                   LRQSLDDSFHLKSAIDGIVWECFQGIPKIYTEDRLAIQKSAIATCYEGKQALDIFTTSE
FT                   IPSGTGLGSSSALAVSVLQALLTSSNVPYSKYDLAEAACRLEIDVLRSPIGKQDQYASA
FT                   FGGLNLIWFYRNETLVEPMQIAPERLRLLEDNLLLFYVGGTRKASEILREQKQATQSNM
FT                   QTLDHLHQLKQLALDMANSLRRGQMNEFGSMLHHAWELKKGLSDKISNPHIDEIYQLTL
FT                   KLGALGGKLAGAGGAGFLMLYVPQTSQPKIKDKLEAFGVREMPFSFDFEGACLLKSGWF
FT                   IVRSNQR"
     atgcaagaga ctatattttc aagagcacca tttagaataa gctttgctgg cggaggtaca        60
     gatctaccgg aatactacga aaagtacgaa ggggtcgtac ttagcactgc cattgacaag       120
     tattgctaca cgatcctgcg acaaagcttg gatgacagct tccacttgaa gtctgctatc       180
     gatgggatag tgtgggagtg tttccaaggc atacctaaaa tatacactga agataggctg       240
     gccatacaga agtcagccat tgcaacgtgc tacgaaggca agcaagcatt agatatcttc       300
     acaacctctg agatacctag tggcactggg ctgggatctt caagcgcact ggccgtatcc       360
     gtgctgcaag cgctacttac atcatccaat gtgccctaca gtaagtatga tttagccgaa       420
     gcagcatgta gacttgagat cgatgtgctt agatccccta taggcaagca ggaccagtat       480
     gcatcggcct ttgggggact aaatcttatc tggttctata ggaatgagac tctggttgag       540
     cccatgcaaa tagcccctga aaggctacgt ttgctcgaag ataatcttct cctgttctat       600
     gtcggaggta cacgtaaagc ctctgagatt ctaagagagc agaaacaagc gacgcaatca       660
     aacatgcaga cgctagacca cctgcaccag ttaaaacaat tggctctaga tatggcaaat       720
     agcctgcgta gaggccaaat gaacgaattt ggttcaatgt tgcaccatgc atgggagctt       780
     aagaagggct tatctgacaa gatctctaac ccacacatag atgagatcta tcagctcaca       840
     ctcaaactag gagctctggg aggaaagcta gcaggggctg gtggtgctgg cttcctaatg       900
     ctctacgtgc cgcagactag ccaacccaag ataaaggaca aactagaagc cttcggcgtt       960
     cgcgagatgc cctttagttt cgacttcgaa ggagcttgct tacttaagtc aggctggttc      1020
     atcgtaagga gcaatcaaag atga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page