(data stored in ACNUC7421 zone)

EMBL: CP001825.PE152

CP001825.PE152       Location/Qualifiers
FT   CDS_pept        164302..164919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0154"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: sus:Acid_2237
FT                   sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41076"
FT                   /db_xref="GOA:D1CDS0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS0"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ACZ41076.1"
FT                   /translation="MIDTIKDYWNGITGSIRKVDLKAIEAAAWEIISCHNSGNNIYIVG
FT                   NGGSAATASHFACDLSKGARVPGQTPFRVLSLTDNMSLVTAWANDSSFEHVFAEQLRPM
FT                   IRQGDLLIVISASGNSPNVVFAAQVARDLGARVLGLTGKDGGKLRNIANLTITVPTEHI
FT                   EQVEDAHLVMAHCICFSIREYLTNKTIKIEDSALQQVFQANI"
     atgattgata cgatcaagga ttactggaac ggtataactg gatcaatacg aaaagttgat        60
     ctcaaggcta tcgaagcagc ggcctgggag ataatctcat gtcataacag cggcaacaac       120
     atatacatcg taggtaatgg cgggagcgct gctacggctt cgcactttgc atgtgacctg       180
     tccaaaggag caagagttcc aggacaaact cctttcagag tattatcact tacagataat       240
     atgtccttgg ttactgcctg ggctaatgat tcgtcctttg aacacgtatt tgctgaacaa       300
     ttaagaccaa tgatcaggca aggggatcta ttgatagtta tcagcgcaag cggcaattct       360
     cctaacgtag tctttgctgc ccaggtagca agggatttgg gagcaagggt attaggactt       420
     acaggcaaag atgggggcaa gctgcggaac atagcaaatc tgacaattac agtgcctacc       480
     gagcatattg agcaggtgga agatgcacat ctagtcatgg ctcattgtat atgcttctca       540
     attagggaat atcttactaa caaaactatc aaaatagagg atagcgcttt gcaacaggta       600
     tttcaggcca acatctga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page