(data stored in ACNUC7421 zone)

EMBL: CP001825.PE157

CP001825.PE157       Location/Qualifiers
FT   CDS_pept        complement(169653..169973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aba:Acid345_1209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41081"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="InterPro:IPR026363"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS5"
FT                   /inference="similar to AA sequence:KEGG:Acid345_1209"
FT                   /protein_id="ACZ41081.1"
FT                   /translation="MVYADKTLTCKDCGATFVFTQGEQEFYASKGLMNEPSRCPDCRRA
FT                   RRAAQNGSSYSNSGPREMYEVTCDSCGRVARVPFQPKGNRPVYCSDCYRQQRESRSSGY
FT                   GY"
     ttggtatacg cggataaaac tctaacatgt aaagactgtg gtgcaacctt tgttttcact        60
     caaggagagc aagagttcta cgctagtaaa gggctaatga atgagcccag caggtgtccc       120
     gattgtagga gagctagaag ggctgctcag aacggctcca gctactccaa cagtgggcca       180
     cgcgagatgt atgaggtaac ctgcgattct tgcggccgag tcgctagagt tcctttccag       240
     cccaagggta atcgccctgt gtactgctct gattgctaca ggcaacagag agagtcccgt       300
     tcttcaggct acggttacta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page