(data stored in ACNUC7421 zone)

EMBL: CP001825.PE158

CP001825.PE158       Location/Qualifiers
FT   CDS_pept        170251..171702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0160"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   afw:Anae109_2921 D-lactate dehydrogenase (cytochrome)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41082"
FT                   /db_xref="GOA:D1CDS6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS6"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACZ41082.1"
FT                   /translation="MNREQLIKKLVTIVGPQGVVHDREQLRTYECDGLANYRAIPTAVV
FT                   LPETTEQVQAIVKLCHRHKIPFVARGSGTGLSGGAMPVEEGILISLSRMRRILEVDIPN
FT                   QRVVVEPGVINLWVTQAVSQYGYYYAPDPSSQLICSIGGNVAENSGGAHCLKYGFTTNH
FT                   VTGLEVVLPDGEIIHIGGKALDTPGYDLVGTVVGSEGTLGVVTKITLRIVRKPEMVSTL
FT                   LAAFATIEQAGAAVSQIIASGIVPAAVEMMDPLSIEAVEAAVHAGYPKAGAVLIVELDG
FT                   PLLEVEDQFNKVKDICLHNGSTEIRIARNEEERVLIWKGRKSAFAAVGRISPNFYVQDG
FT                   VIPRTALPDVLREIEEISAQSGIRVANVFHAGDGNLHPLVLYDASIPGQEEKAEQVAGE
FT                   ILSICLRYGGSITGEHGVGVDKKKYMPKMFSEEDMNAMHMLRCAFDPEGICNPGKVFPT
FT                   PRLCGERPGPGKIHPLQEAGLAEIF"
     atgaatagag agcagctaat aaaaaaattg gtcacgatcg ttggacctca aggagtagta        60
     cacgatagag aacagcttag gacttatgag tgtgatggct tagctaacta tagagctata       120
     cctacagctg tagttctgcc agaaactact gagcaggtac aagctatagt caagttatgt       180
     caccgccata agattccatt tgtagctaga ggctcaggta caggactttc aggtggagcc       240
     atgcctgtcg aagaggggat acttatctcc ctctccagaa tgaggagaat tttggaagtc       300
     gacattccca accaaagagt agtagtcgag cctggagtta taaatctatg ggtcacccag       360
     gcagtatcac agtacggtta ctactacgca cccgaccctt ctagccagtt gatctgctcg       420
     atagggggaa atgtagctga aaactcagga ggagctcatt gtctgaagta tggcttcacc       480
     actaatcatg taactggtct ggaggtcgtg ctaccagatg gcgagattat acacatcgga       540
     ggaaaagctt tagacacacc aggatacgac cttgtgggaa ctgttgtagg atccgaaggc       600
     acattagggg tagtcacaaa gataacgctt cgcatagttc gcaagccgga gatggtaagc       660
     acacttctag ccgcttttgc cactatagag caagctgggg cagcagtatc gcagatcata       720
     gcgtcgggca tagtgcctgc agcagtcgaa atgatggatc cactttcaat tgaggccgta       780
     gaggcggcgg tacatgctgg ctatcccaag gctggagcag tgctgatagt agaactggat       840
     ggaccactcc tagaagttga ggatcagttc aataaagtaa aggatatttg tctacacaat       900
     ggctctacag agatacgaat tgcacgtaat gaagaggaaa gagtattgat ctggaaggga       960
     cgcaaatcag cctttgctgc agtcggcagg ataagtccta acttctatgt acaggatggc      1020
     gttatcccta gaacggcact gccagacgtg ctgcgagaga tagaagaaat aagtgcccaa      1080
     agcggcataa gagtagccaa cgtttttcat gccggcgatg gcaacctgca tccattagtg      1140
     ctatacgacg ccagcatacc tggtcaggaa gagaaagcgg agcaggtagc aggagagatc      1200
     ttatcaatct gtctcaggta tggaggatcc attactggtg agcatggggt aggagtagat      1260
     aagaagaagt atatgcccaa gatgttctca gaagaagata tgaatgctat gcacatgttg      1320
     cgatgtgctt tcgaccctga aggcatatgt aaccctggca aagtctttcc tacaccacgt      1380
     ctgtgtggtg agagaccagg cccaggtaaa atacacccac tgcaggaagc aggtttggca      1440
     gagatcttct ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page