(data stored in ACNUC7421 zone)

EMBL: CP001825.PE159

CP001825.PE159       Location/Qualifiers
FT   CDS_pept        171702..172967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0161"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ade:Adeh_2866 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41083"
FT                   /db_xref="GOA:D1CDS7"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS7"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ACZ41083.1"
FT                   /translation="MAILDITDKLPNIEIENTPTNIDGVQPEYIAKPESPTDTVEILKY
FT                   AHQKGIGVIPFGSGTKLGWGNPPQRCDLLINTAKLDKIIEYSPDDLIVKVQAGIKLEEL
FT                   QQELRKHNQMLALDPPEKSATIGGIIAANASGPRRLRYGTTRDLLIGITVALTNGDLVH
FT                   GGGKVVKNVAGYDLCKLFTGSLGTLGVIVEAVFRLHPLPTKSFILKVNLKDLDQAEQCI
FT                   QQVLNSYLVISALEAHCSSTGEVSLWCMVEGSSENIARSAAGALRQILSNYGDCQVFDL
FT                   EEDPAVYNNLRQYPWEADDLGIKFSSTISRLKPIAMLARSTSQRHGCEFELRSHAGSGI
FT                   TYLAVKGGKNLPVDAQVSLIQSIREALTSEDSAMVLEASLPLKQRIDVWGYAGDALPLM
FT                   KRIKDQFDPAKILSPGRFVGGI"
     atggcaatac tcgatataac agacaaacta cccaatatag agatcgaaaa cacaccaacc        60
     aatatagatg gggtgcaacc agagtatata gctaaaccag aatcccccac ggatactgta       120
     gagatactca agtatgcaca tcagaaagga atcggtgtta tacccttcgg ctctgggaca       180
     aagttagggt ggggtaatcc tccccagaga tgcgacctgc tgatcaacac cgcaaaactt       240
     gacaagatca ttgagtacag cccagacgac ctcatagtca aggtgcaggc aggtataaag       300
     ctggaagagc tgcaacaaga gctgcgaaaa cacaatcaga tgcttgccct agatccccca       360
     gaaaagtccg ctactatagg ggggataata gctgcaaacg cctctggtcc tagaaggctc       420
     aggtatggta ctaccaggga tctacttata ggaataaccg tagctctaac taatggcgat       480
     cttgtgcacg gcggaggcaa agtcgtcaag aacgtggctg gttatgatct ttgtaagttg       540
     ttcacaggct ccttagggac gctaggagta atcgtagagg cagtatttag gttgcatccc       600
     ttacctacca agtcctttat attgaaagtg aacctcaaag atcttgatca agcggaacaa       660
     tgtatacaac aagttctaaa ctcatatcta gtgatatcag ctcttgaagc tcattgtagc       720
     agtacaggcg aggtctcttt atggtgtatg gtagagggct cttcagagaa tatagcacgc       780
     tcagcagctg gagccctacg gcaaatactg agtaactatg gggattgtca ggtttttgat       840
     ctcgaagaag acccagcagt ctataataat ctcaggcagt atccatggga agcagatgat       900
     ctcggcataa agttctcctc taccatctcc agactcaaac ccatagcaat gctggccagg       960
     tcgacatctc aacgacatgg ttgcgagttt gagcttagga gccatgcagg atcaggcata      1020
     acttatctag ccgtaaaggg aggcaaaaac ctacctgtag atgctcaggt atcattgatt      1080
     caatcaataa gggaagcttt gacatccgaa gactctgcta tggtcctgga ggcaagctta      1140
     cccctcaagc agaggataga tgtatgggga tatgctggag atgcactgcc ccttatgaag      1200
     aggatcaagg atcagttcga tcctgcaaag atactcagcc caggcaggtt cgtgggagga      1260
     atataa                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page