(data stored in ACNUC7421 zone)

EMBL: CP001825.PE161

CP001825.PE161       Location/Qualifiers
FT   CDS_pept        174340..175530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0163"
FT                   /product="Alanine--glyoxylate transaminase"
FT                   /EC_number="2.6.1.44"
FT                   /note="PFAM: aminotransferase class V; KEGG: ade:Adeh_2994
FT                   alanine-glyoxylate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41085"
FT                   /db_xref="GOA:D1CDS9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS9"
FT                   /inference="protein motif:PRIAM:2.6.1.44"
FT                   /protein_id="ACZ41085.1"
FT                   /translation="MTVGIQPRTITVPKRLLLGPGPSELDPEVARALSLPSLGHLDPAM
FT                   VEIMQDIKRLLQYTFVTRNEATLAVSGTGTSAMETALANVIEPGDKVLVGIMGYFGDRL
FT                   AQITAKLGGQVIRVEAEWGKAIDPDMIIARIKEVTPQVVCLVHAETSTGVVQPEIEHIS
FT                   SAAHEVGAVLVVDTVTSLGGQPVKVDDWGIDVCYSAGQKCIGAPSGLSPITFGELALDK
FT                   INKRTTPVSSFYLDLNLLRNYWDSQQYHHTISAPLVYALHTALDKIQQEGLENRWKRHE
FT                   INQRAFLAGVEALSLDLLAEKDHRLNTLITIKTTEDIAERTIRQELLNDYSIEVGGGIG
FT                   PFQGKLLRIGLMGYGSRREFIIQLLAALESILRKHGRPVPEGCSVAAAMKVYETAL"
     atgacagttg ggattcagcc aaggacgatc acagtaccca agcgattact tcttgggcca        60
     ggacctagtg agcttgatcc cgaggttgcg agagcattat ctcttccctc tctagggcat       120
     ctcgatccag caatggtgga gataatgcag gatatcaagc ggctcctgca atacacattc       180
     gtgaccagga atgaggctac tctagctgtt tctggtacgg gcacatctgc catggaaaca       240
     gctttagcta atgtgattga gcccggcgat aaggtgctcg taggtataat gggctatttt       300
     ggtgatcgcc tggctcaaat aactgccaag ctgggaggcc aagtaatcag agttgaagca       360
     gagtggggga aagctattga cccggatatg ataattgctc gcataaaaga ggtaactccc       420
     caagtggtct gtcttgtaca tgcggagaca tctaccgggg tcgtccagcc agaaatagaa       480
     cacatctcct ctgcggccca tgaagttggg gccgtgttag tagttgatac tgtgacatcg       540
     ctaggtggac agcccgtgaa ggtagacgat tggggaatag atgtatgtta cagcgcagga       600
     cagaagtgca ttggggctcc ttctgggctc tcaccaatta cctttgggga gctagcctta       660
     gataagatca acaaacgcac aacccctgtc tcaagttttt atctggattt gaacctgttg       720
     cgcaattact gggatagcca gcaatatcat cacactatat ccgcaccgct cgtctatgcc       780
     ctgcacacag ctctcgacaa aatacagcaa gagggactag aaaacaggtg gaaaagacat       840
     gagataaacc agcgagcatt cctggctgga gtagaagccc taagcttgga ccttctagct       900
     gagaaagatc atagactcaa tacgctgatt actataaaga ccacggaaga catcgcagag       960
     agaaccataa gacaggaact gctcaacgac tattcaatag aggtaggagg tggtatagga      1020
     ccgttccaag gcaaactgct gaggattggt ttaatgggct acggatcaag aagagagttt      1080
     atcatccagt tgcttgcagc cttagaatca atattgcgca agcacggaag acccgtacca      1140
     gaagggtgtt cagtagcagc agcaatgaaa gtctatgaaa cagctctgta g               1191
//

If you have problems or comments...

PBIL Back to PBIL home page