(data stored in ACNUC7421 zone)

EMBL: CP001825.PE162

CP001825.PE162       Location/Qualifiers
FT   CDS_pept        175546..176451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0164"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: sde:Sde_2639
FT                   fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41086"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT0"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACZ41086.1"
FT                   /translation="MSSNNQVYGGIEAGGTKFVCAVGTGPDDIRSSITFPTTYPEETLE
FT                   KAVSFFRQATKGLTLVAIGIASFGPVDPNPLSPTYGYITSTPKPGWANTNFAGYIRESL
FT                   GVPVGFDTDTNVAALGEHRWGAAVGLETFIYLTVGTGIGGGGLVNGKLIHGMLHPEMGH
FT                   LAIPHDKEEDPFEGWCKFHKDCLEGLASGPAIESRWGVRGENLPADHPAWQLEAKYLAF
FT                   GLVNYIYTLSPQRIIMGGGVMQQSHLFPLIRQRVQHLLNGYIQADDVLQRIDQYIVPPK
FT                   LGTRAGVLGAIALAQDTVGD"
     ttgagctcga acaaccaagt ctatggggga atagaagcag gtggtaccaa gtttgtatgc        60
     gctgtaggta ctggaccgga tgatattagg tcatctatta cttttccgac cacctatcca       120
     gaagaaactc tggaaaaagc ggtaagcttc ttcaggcagg ctactaaagg tttgacgcta       180
     gtagccatag gaattgcatc ctttggacca gtagatccta atcccttatc tccgacttac       240
     gggtacatca catctacacc taagccagga tgggccaaca ccaactttgc aggatatatc       300
     agagaatccc ttggagttcc agtaggattt gatacagata ctaatgttgc agcgctggga       360
     gagcacagat ggggagcagc agtgggactt gaaaccttta tctatctgac tgtgggcacg       420
     gggataggtg gaggaggact agtcaacggc aagcttattc atgggatgct tcatcccgag       480
     atggggcatc ttgctattcc ccacgacaaa gaggaagacc cttttgaagg ctggtgcaag       540
     ttccataagg attgtcttga gggattagct tcaggaccag ctatcgaatc caggtgggga       600
     gtaagaggcg agaacctccc tgcggatcat ccagcatggc agctggaggc taagtacctg       660
     gcttttggcc tagtaaacta tatctacaca ctgtcccccc agcgcatcat catgggaggc       720
     ggagtaatgc aacaatctca tctgttccct cttattcgcc agcgagttca gcatttgctt       780
     aatggatata tacaagcaga tgacgttcta cagcgaattg atcaatatat agtcccacct       840
     aaactaggaa ccagggcagg cgtgctcgga gcgattgcac tagcgcagga tactgtcggg       900
     gactaa                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page