(data stored in ACNUC7421 zone)

EMBL: CP001825.PE163

CP001825.PE163       Location/Qualifiers
FT   CDS_pept        176576..177094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0165"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: sil:SPO1634 shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41087"
FT                   /db_xref="GOA:D1CDT1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT1"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ACZ41087.1"
FT                   /translation="MQNVNSKHIVLIGLSGSGKSTVGCLLASKMGLPYIDTDREIEKHT
FT                   GMPIEEIFSKFGEGKFRQLESDQINRALKGKRAVVSLGGGAVLLEENRKLIWDLSTVIW
FT                   LQASIETIANRLKHTKEIRPLLAGDDLMRRLENMLQNRERYYSQAHLCIVTDNKSPYTI
FT                   VEEILSFVR"
     atgcaaaacg tgaattcaaa acatatcgtg ctcataggac taagcggtag tggcaaaagt        60
     accgtggggt gtcttttggc ctccaagatg gggctacctt atatagatac cgaccgggaa       120
     attgaaaagc acacaggcat gccgatagag gagatcttct ctaagtttgg agaagggaag       180
     tttcggcaat tggaaagtga tcaaataaat agagccctga agggtaaaag ggccgtggtt       240
     tcgcttgggg gtggagctgt cctgctggaa gagaaccgca agctgatatg ggatttatcc       300
     acggttatct ggctgcaggc aagcatagaa actatagcca acaggctgaa acatactaaa       360
     gagataaggc cactgcttgc aggtgacgac ttgatgcgta gactggagaa tatgctccag       420
     aatagagaga ggtattactc tcaggcacac ttatgcatag tgacagataa caaatcgccc       480
     tacactatag tggaagaaat actctctttt gtgcgttga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page