(data stored in ACNUC7421 zone)

EMBL: CP001825.PE166

CP001825.PE166       Location/Qualifiers
FT   CDS_pept        complement(178190..178354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41090"
FT                   /db_xref="GOA:D1CDT4"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41090.1"
FT                   /translation="MIADLLYWIGTLLIIGFVFLCVPILFMLIVTAHYYLAEGELRRSF
FT                   RKASEVRRL"
     atgatagcgg atctgcttta ctggataggg actttattga tcataggctt tgtctttttg        60
     tgtgttccga tactgttcat gcttatagtg actgcccact attatcttgc ggaaggggag       120
     ctgagaagat cttttcgaaa agccagtgag gtaagaaggc tatag                       165
//

If you have problems or comments...

PBIL Back to PBIL home page