(data stored in ACNUC7421 zone)

EMBL: CP001825.PE169

CP001825.PE169       Location/Qualifiers
FT   CDS_pept        complement(180826..181626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41093"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41093.1"
FT                   /translation="MTKAGIGVESNLTYYSRVSAMHVNTYYDLLTAFRLEGCPICRLVR
FT                   LAVDSYLDSLDYEFINDAKVRKDLVVSFGFCKDHAEQWFERPRLLATCILYRDVVAYLG
FT                   YHLHLKRRELFEKRSSRGWNRRLRSSLENIRRLIKSKPVCPVCDFQQEEEHKYLSALLQ
FT                   GFEDESFEEAYMKSHGLCLLHLFLGLDIAAEDSSVSILLIDKALMEQRKHMDLVVQCLQ
FT                   SQSYNSVAAYTPKSSEIYSIVQHLCGDPRLDRKPQIHCEKNTLA"
     ttgactaaag caggaatagg ggtagaatct aatttgacat attattcgcg ggtgtctgct        60
     atgcacgtca acacctacta tgaccttctt acagcttttc gcctagaagg ctgtccaata       120
     tgtcgtcttg tccgtttagc ggtagattcg tacttggata gcctagatta tgaatttata       180
     aatgatgcca aggttaggaa ggatttagtt gtctcctttg ggttctgcaa ggaccatgct       240
     gagcaatggt ttgaaagacc aagacttcta gcgacatgca ttctctaccg ggatgtggtt       300
     gcctacctag gctatcatct tcacctcaaa agaagagagt tgtttgagaa gagatcttcg       360
     agaggatgga atcgtaggtt gaggagcagc ttggagaaca taaggaggct catcaaaagc       420
     aagccggtat gtccggtttg tgactttcaa caagaggagg aacataaata cctgagcgct       480
     cttcttcaag ggttcgaaga tgagtcgttt gaagaagctt atatgaagtc tcatggcttg       540
     tgtcttcttc atctgttttt ggggcttgat atagctgccg aagactcaag cgtatctatt       600
     cttcttatag ataaagcgct tatggagcag agaaagcata tggatttagt agtgcaatgc       660
     ttgcaatccc aaagctacaa ctctgttgct gcttatacac ccaaatcctc ggagatctac       720
     tctatagttc agcacctctg tggtgatcca aggttagata gaaagcccca gatacattgt       780
     gaaaagaaca cattggccta a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page