(data stored in ACNUC7421 zone)

EMBL: CP001825.PE171

CP001825.PE171       Location/Qualifiers
FT   CDS_pept        complement(183644..184003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0173"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: aav:Aave_2238 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41095"
FT                   /db_xref="GOA:D1CDT9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ41095.1"
FT                   /translation="MLMKKVLIVDDEAEIVELIVMVLDDGQVQLLTAYDGEQAMRIIKE
FT                   QRPDVVLTDVMMPRLDGRELCKMVKSDPSISDTKVILMSAIHRLDKGDCPADGLIHKPF
FT                   DIVAIVEAVHKFLDQ"
     atgcttatga aaaaagtgct tatagttgat gatgaagctg agatagttga gctaattgtg        60
     atggtccttg atgatggcca agttcaactg ctcacagcct atgatggtga gcaggcaatg       120
     cgtatcatca aggagcagag acccgatgtt gtgcttacag acgtgatgat gcctaggctg       180
     gatggcagag agctttgtaa gatggtcaag tcagatccat caatctccga taccaaagtt       240
     atactcatga gcgctataca tcggctggat aagggtgatt gtccagccga tggccttatc       300
     cacaagcctt ttgacatagt tgccatagtg gaagcggttc acaaatttct agaccaataa       360
//

If you have problems or comments...

PBIL Back to PBIL home page