(data stored in ACNUC7421 zone)

EMBL: CP001825.PE172

CP001825.PE172       Location/Qualifiers
FT   CDS_pept        complement(184034..185419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0174"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="PFAM: KaiA binding; KEGG: bxe:Bxe_B0484 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41096"
FT                   /db_xref="GOA:D1CDU0"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU0"
FT                   /inference="protein motif:PRIAM:2.7.11.1"
FT                   /protein_id="ACZ41096.1"
FT                   /translation="MDKISTGIPGFDVLLGGGIPKGSFVLVGGPPGVGKTILVTQMAFH
FT                   HASQGKKVVMLTALTETNAKLIAHLSTLAFFDDALLGNTLQILNIQKLLQEEGLDKTLA
FT                   EIRSTVIEQGVELLVIDSFRSLFTLTGDAAAVQNFIFNLSSALFMLGCTTLMVEDQYRM
FT                   DGFIHPEQAISDTIIHLSLSSLNSSATRKIEVLKMRGGDPIPGKHYFEITPSGIAIYPR
FT                   IESLASKVWPCDTNKRVSWGVAGLDEITGGVPVCSSNLVLGPLGVGKSLLSLQFLAAGI
FT                   REGQRVLFATFYDTLEDLSRRLSSVGVDLEDALNKGNVIAIQFPFSDISADKLVHQIIS
FT                   QLPESSSSRLVIDGFEVVREELDRDGRFMPFVGALAQIMRSRNVTTLITCGDKSMSLWA
FT                   ASPEWAPMDNVLTMDRINLSGELRRVLTIVKMRGIEHDNTVYEFTITPTGIEIKDKVEE
FT                   IGR"
     gtggacaaga taagtacggg tattcctggc tttgatgtgc tccttggtgg gggtatacct        60
     aagggttcat ttgtgctggt tggaggtcct ccaggcgttg gcaagactat attggttacc       120
     cagatggcct ttcaccatgc atctcagggc aagaaagtag ttatgcttac tgcccttact       180
     gagactaacg ctaagcttat agcacatctt agtaccctgg ccttttttga tgatgccttg       240
     ctcggtaata cccttcagat tctgaatata caaaagctgc tgcaagaaga gggcttagat       300
     aagactcttg ccgagataag gagcacagtg atcgaacagg gagtagaact tctagtaata       360
     gactcattta gaagtctttt caccctcact ggagatgcag ctgccgtaca aaactttatt       420
     ttcaatctga gttcggcgct attcatgctt ggatgcacca ccctgatggt tgaagatcaa       480
     tacaggatgg atggcttcat tcatccggaa caggcaataa gcgacaccat cattcatctt       540
     agcttgtcaa gcctgaacag tagtgctact aggaagatag aggtactcaa gatgagggga       600
     ggtgatccta tccccggcaa gcattacttt gagatcacac cctctggtat tgcaatatat       660
     ccaaggatag aatccttagc tagcaaagtt tggccttgtg atacgaataa aagggtgagc       720
     tggggggttg ctggattaga cgagataacg ggaggtgtcc ctgtttgctc atctaatctg       780
     gtactaggcc ctcttggagt tgggaagagc ttgttgtctt tgcagtttct agcagcaggt       840
     ataagggaag gccagagggt cttattcgca actttctacg atactcttga agatttatct       900
     agacgtctat ccagtgtggg agtagatcta gaagatgctt tgaataaagg taatgtcatc       960
     gccattcagt tccccttctc tgatataagt gcagacaagc tagtacatca gattatctct      1020
     cagttaccag agtcttcctc atctcgactc gtgattgacg gctttgaggt tgtaagggaa      1080
     gagctggata gagatgggcg atttatgcct ttcgttggtg ccttggccca gataatgcgt      1140
     tcacgcaatg tgactactct tatcacatgc ggtgataaaa gcatgtcgct gtgggctgcc      1200
     tctcctgagt gggcaccaat ggataacgtc ctgaccatgg acaggataaa tttgagtggg      1260
     gagttgagga gagtactgac catcgtgaaa atgcgtggca ttgagcatga taacacggta      1320
     tacgagttta caattacgcc aaccggtata gagataaaag ataaggttga ggagattggt      1380
     cgctag                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page