(data stored in ACNUC7421 zone)

EMBL: CP001825.PE175

CP001825.PE175       Location/Qualifiers
FT   CDS_pept        complement(188243..189499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0177"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   pla:Plav_0678 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41099"
FT                   /db_xref="GOA:D1CDU3"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU3"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ACZ41099.1"
FT                   /translation="MSVRSNELLGVEKLPNGLTVVGQRMPGVESVAICFHVRTGSRDEP
FT                   QDIAGVSHFLEHMMFKGTTRRSAVDISREFEEMGAEFNAFTWVESTVYYARVLGDQLPR
FT                   AVDLLADMMRPALDEKEFETEKGVIIEEIARSEDQPAHELIHQLFANFFESHPLGNSVL
FT                   GTQDTIRNMPVHRMREYHQRRYGANNIIFGIAGNFDWDKLLPMLEEVTRGWEPSEEGHQ
FT                   KVEFKPTPKVRVDLKPQFQQEHIAIASSAPKQDEDDTWAAELVASVLGDSTGSRLFWEV
FT                   TQKGLVDSIETEYYGFDDAGLYLTYFSTSPDRAEEVLRVVRQEMQKLQQDGVDQDELDR
FT                   AKVKAVADIVIGGEASHRRMFELASLYVAKSKAMSVDEIVDSIESVSQEDIRRVLERYP
FT                   FTETFTVQAAGPLSDLNVS"
     atgtcagtaa ggtctaatga gctgctagga gtcgagaaac ttcccaatgg tctgacggtt        60
     gtagggcaga ggatgcccgg agtggaatcc gtagccatat gtttccacgt gcgtacaggg       120
     tctcgagatg agccccaaga catagctggt gtttcccact ttctagagca catgatgttt       180
     aaaggcacta caagaaggtc agcggtcgat atctccagag agttcgagga gatgggagct       240
     gaattcaatg cttttacctg ggtagagagc actgtgtact atgctagagt gcttggtgat       300
     cagctcccta gggctgtgga cctgctggcc gatatgatgc gtcctgctct tgacgagaaa       360
     gagttcgaaa cagagaaagg cgtgatcata gaggagatag cgcgctctga ggatcagcca       420
     gcacatgagc ttatacacca gcttttcgct aacttcttcg aatctcatcc tttaggtaac       480
     agtgttttgg gaactcagga taccattcgc aacatgcccg tacacaggat gcgtgagtac       540
     catcaaagaa gatatggggc taacaacatc atctttggta tagcaggcaa ctttgattgg       600
     gacaaactgc tcccaatgtt ggaagaggtt acgcgtggat gggaaccttc tgaggagggg       660
     catcagaagg tggagttcaa accaactcca aaagtgaggg ttgatctcaa gcctcagttt       720
     cagcaggaac atatagctat agcttcgagt gcgcctaagc aggatgagga tgatacttgg       780
     gcagctgaac tcgtagcctc tgtactaggg gattcaactg ggtctcgtct cttctgggaa       840
     gtcacacaga aaggactggt cgattcaatc gagactgagt attacggttt tgatgacgcg       900
     ggactttacc ttacatactt cagtacttct cctgataggg ctgaggaggt ccttagagta       960
     gttaggcagg agatgcagaa gctacagcaa gacggtgtag atcaggatga gctagatcgg      1020
     gcgaaggtga aggccgtcgc ggatatcgtg attggtgggg aggcttctca ccgcaggatg      1080
     tttgagctgg cgagcttgta cgtggccaag agcaaggcta tgtccgttga cgagatcgtt      1140
     gatagtatcg aaagtgtatc ccaggaggat atacgtcgag tacttgaacg atatcccttt      1200
     actgagacct ttacggtaca agctgctggt cccctttctg atctgaacgt ttcgtag         1257
//

If you have problems or comments...

PBIL Back to PBIL home page