(data stored in ACNUC7421 zone)

EMBL: CP001825.PE176

CP001825.PE176       Location/Qualifiers
FT   CDS_pept        complement(189483..190748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0178"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   sus:Acid_7201 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41100"
FT                   /db_xref="GOA:D1CDU4"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU4"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ACZ41100.1"
FT                   /translation="MPEQYKDVLPNGLTVLGERLEGVRSLALGFIVGAGSSYDPDDKSG
FT                   LAHFTETMLLEGTTNRTSRQISDSLDSLGVSYGTSLDAETIGLSGVMVSSRLEPALEIF
FT                   ADILQNPSFPEDEMEQTRSSILQELRREEDEPMVKVRDLLRRVYYEGHPYSKRPTGEPD
FT                   VISSLSSADLREYHASYFNPANTVCAAAGDLDWDLFRSLVEKFLGGWKPGTKAPEIGPP
FT                   HPRPQLYVENQQTQQEHIAGAAPSVPFGHDDYYAAIIAAEILGGGMSSRLFVEVREKRG
FT                   LVYSVGASYSPGRYQGSWRIYAGTTPERASQTYSVLMEELHKLDSEGVSEEEFRRFQAL
FT                   TRSHVLMAGESTSARLRSLLTSWWYEGRIKPLSYIRERIDAVTVDQVNKVVREWPLSSN
FT                   LVLCALGPSTKESLVGENVSKV"
     atgcccgagc aatataagga tgttttgcct aatggcttga ctgttcttgg agaaagactc        60
     gagggtgtta gatctctggc tctaggcttt atagttggag ctgggagttc ttatgatcct       120
     gatgataaaa gtgggctcgc ccatttcacc gaaactatgc tcctagaagg taccaccaac       180
     aggacttctc gccagataag cgattcactt gactccttgg gagtgagcta cggtacttcc       240
     ttggatgccg aaactatagg gctctcggga gtgatggtta gctccagact agaacctgca       300
     ctggagatat ttgcagacat acttcagaac ccaagcttcc cagaagatga aatggagcag       360
     acccgatctt ccatattgca ggagcttcgg cgcgaagagg atgaacctat ggtaaaggtt       420
     cgggatctgc tacggagggt ctactacgag ggacatccct attctaagag gccaacaggg       480
     gagccggatg ttatcagttc cctttcttct gctgacttga gggaatatca tgcatcttac       540
     ttcaatcctg ccaatacagt ctgtgcagca gctggggacc tagattggga tctgttcaga       600
     tctctggtag agaagtttct tggaggttgg aaacctggga ccaaggctcc cgagataggg       660
     ccacctcacc ctcgtccaca attgtatgtg gaaaatcagc agactcagca agaacatatc       720
     gctggtgcgg cgccgagtgt tccattcgga catgacgatt attacgctgc tattattgct       780
     gccgaaatct tgggtggagg catgagtagc agactttttg tagaggtgcg tgagaaaaga       840
     ggtctggtat attcggtggg cgcatcttat tctcccggta ggtatcaagg ttcatggaga       900
     atatatgcag ggactactcc tgaaagggct tctcagactt atagcgtgtt gatggaggag       960
     ctgcacaagt tagactccga gggtgtgtcc gaggaggagt ttagaaggtt ccaagcgcta      1020
     actcgaagcc atgtgcttat ggccggcgaa agcacgagtg cgaggcttag atctctcttg      1080
     acctcatggt ggtatgaggg caggataaag ccactttcct acatacgtga gaggatagat      1140
     gctgtcactg ttgatcaggt gaacaaggtt gttagggaat ggcctttgag ctccaatttg      1200
     gtgttgtgtg ctctaggccc aagtacaaaa gaaagcttgg tgggtgaaaa tgtcagtaag      1260
     gtctaa                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page