(data stored in ACNUC7421 zone)

EMBL: CP001825.PE178

CP001825.PE178       Location/Qualifiers
FT   CDS_pept        complement(191896..192375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0180"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bce:BC2074 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41102"
FT                   /db_xref="GOA:D1CDU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ41102.1"
FT                   /translation="MKIRRMMQEDIPSVRHVAEVTWHHTYKNIIPEHIRTEFLATAYSD
FT                   KSLNYRMRNNVLLVVEDAGHLVGFAEFTPLQDSSEVELSAIYILPSHQGKGIGTQLLQE
FT                   GIKNFPDAKVIKLRVESRNAPAKSFYLAKGFLPTREYTILIHGYSCEITEMEKHL"
     ttgaaaatcc gcaggatgat gcaagaagat ataccctcgg taaggcatgt agcagaagtt        60
     acctggcacc atacctacaa gaacataatc ccggagcata taaggaccga gtttctggct       120
     acggcttatt cggataagtc gctgaattat aggatgagga ataatgtcct gctcgttgtg       180
     gaggatgcag gccacttagt aggttttgct gagtttacac ctcttcagga ctcttccgaa       240
     gtggagctat ctgcgatata tattcttccc agccaccagg gtaaaggtat aggcactcag       300
     cttcttcaag aagggatcaa gaatttccca gatgccaagg tgatcaagct cagggtggaa       360
     agcagaaatg ctcccgctaa aagcttctac ctagccaaag gctttttacc tacgcgcgaa       420
     tataccatac tgattcatgg ttatagctgt gagattactg agatggaaaa gcatttgtga       480
//

If you have problems or comments...

PBIL Back to PBIL home page