(data stored in ACNUC7421 zone)

EMBL: CP001825.PE179

CP001825.PE179       Location/Qualifiers
FT   CDS_pept        192521..194788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0181"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: mmw:Mmwyl1_0214 glycoside hydrolase family 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41103"
FT                   /db_xref="GOA:D1CDU7"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU7"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ACZ41103.1"
FT                   /translation="MTRDIKSLIAQMTLEEKASLCSGLGFWDTKPIERLGIPSIVMTDG
FT                   PHGLRKQVPGSQNFFDSVPATCFPTAATIACSWDRSLVREIGIALGEECQAEGVSVILG
FT                   PGVNIKRSPLCGRNFEYFSEDPFLSTELAASYIEGVQSQGVGTSIKHFAANNQEHRRMS
FT                   VNAIVDERTLREIYLASFEGAVKKSKPWTVMCAYNRLNGDYCSENHYLLTKVLREDWGY
FT                   EGLVVSDWGAVNERVKGLEAGLDLEMPGNGGVGDRKIIEAVCSGELSEEVLDRAVERIL
FT                   KLIFQAVDNRKENFRYDADAHHQLARKAARESMVLLKNDNSILPLRKEGTIAVIGAFAK
FT                   HPRFQGGGSSHVNPTRIDIPYDEIQKAVGDSARLLYSDGYQLGSDEVNQSLIEEARQIA
FT                   SQANVALIFAGLPENYESEGYDRVHMSMPRSHLELIQAVSESQPNTVVLLCNGAPVEMP
FT                   WLHDVPAVLECYLGGQAVGSAIADLLFGEASPCGKLAETFPQKLSDNPSYLNFPGEDDK
FT                   VEYREGIFVGYRYYDTKEIEPLFPFGHGLSYTTFEYSDLSVDKKSIKDNEVVNVQVTVK
FT                   NTGKFAGKEIVQLYVSDLASSVRRPEKELKGFEKVELQPGEEKTVNFTLDKRAFAYYNV
FT                   DLSDWYVETGEFEICVGRSSRDIVLTEIIHVDSTQVIPKRYHRNSLIGDLQEDPKAAAL
FT                   FNQMMQQGLANTPFASSGEFNSEMIMALLRYMPLRALVNFSGGAFSEDDLNNLLDQLNS
FT                   AS"
     ttgaccagag atatcaagtc tttgatcgct cagatgaccc tggaggaaaa ggcaagccta        60
     tgctcaggac taggcttctg ggataccaaa cccatagaga gactaggaat accttctata       120
     gtcatgactg atggccctca tggactacga aagcaagtcc ccgggagcca aaacttcttc       180
     gacagcgtgc ctgccacttg tttcccaaca gcagctacta tagcctgctc ctgggacaga       240
     tctttagtaa gagagattgg catcgccctg ggagaggaat gccaagctga aggtgtatct       300
     gtgattttgg ggcctggagt aaatataaag cgttctcctc tatgcggacg caacttcgaa       360
     tacttctcag aggacccatt tctttctacg gaattagcag ccagctatat agaaggcgta       420
     caaagccaag gggttggcac gtccatcaag cactttgccg ctaacaatca ggaacaccgc       480
     aggatgtcgg tcaacgcaat agttgacgaa aggaccttac gagagatcta cctggcgagc       540
     ttcgaaggag cagtaaagaa atccaagccc tggacggtaa tgtgcgccta taacaggttg       600
     aacggcgatt attgttctga gaaccactac ctgctcacga aggttttgcg agaagactgg       660
     ggatatgaag gattagtagt ttctgactgg ggagcagtca acgagagggt aaagggactc       720
     gaggctggcc tagatctgga gatgcccggt aacggcggcg ttggagatcg caagatcatt       780
     gaagcagttt gctctggaga gctatcagaa gaggttttgg atagagcagt tgagcgtatc       840
     ctgaaactaa tcttccaagc cgttgacaat agaaaggaga acttccggta cgacgctgac       900
     gctcaccatc aactagcaag aaaggctgcc agggaaagca tggttctcct caagaacgat       960
     aactctatct taccccttcg gaaagaagga actatagcag ttataggagc attcgccaaa      1020
     catcccagat tccaaggagg aggcagttca cacgtcaacc ccactcggat cgacataccc      1080
     tatgatgaga tccaaaaggc agtaggtgat tccgccaggc tactctattc agatggttac      1140
     caactgggaa gcgacgaagt aaaccagtcc ttaatcgaag aagccaggca aattgcctct      1200
     caggcgaacg tagcactaat attcgcagga ctacctgaga attatgagtc cgaaggttat      1260
     gatagggtcc atatgtcgat gcctaggagt cacctggagc ttattcaagc agtcagcgaa      1320
     tctcagccaa atactgtggt gctgctatgc aatggtgcac ccgtagagat gccttggctg      1380
     catgatgtac ccgctgtgct agagtgctac ctgggagggc aggctgttgg tagcgctata      1440
     gctgatctgt tatttgggga ggctagcccg tgcggcaaac tcgctgagac gttcccacaa      1500
     aagctaagtg acaatccttc atacctcaac ttcccaggcg aagacgacaa agtagagtac      1560
     cgcgaaggta tattcgttgg atacagatac tacgacacaa aggaaatcga gcctttgttc      1620
     ccattcggtc atggtctgag ttataccacg tttgagtata gtgatctatc cgtagacaag      1680
     aagagcatta aagataacga ggtcgttaac gtacaagtaa ctgttaagaa cactggcaaa      1740
     ttcgccggga aagaaatagt acagctctat gtaagcgatc tagcttcaag cgttagaagg      1800
     ccagaaaaag agctcaaagg ctttgagaag gtagagctac agcctggaga agagaaaaca      1860
     gtcaatttca cgttggacaa aagggctttt gcatactaca acgtggacct tagcgattgg      1920
     tacgtggaga caggggaatt tgagatctgc gtagggagat cctctagaga tattgtcctt      1980
     accgagatca tccacgtcga ctccacacag gtaataccaa agaggtacca tcgcaactca      2040
     ttgatagggg atctgcagga ggatcctaaa gccgctgctc tcttcaacca aatgatgcag      2100
     cagggattgg cgaacacacc gttcgcttca tcaggagagt tcaacagcga aatgataatg      2160
     gcccttctaa ggtatatgcc gcttagagca cttgtgaact tcagtggtgg agccttcagc      2220
     gaagatgatc ttaataactt attagaccag ctcaactcag ctagttaa                   2268
//

If you have problems or comments...

PBIL Back to PBIL home page